KEGG   T30302 (Metagenome): 13066
Entry
13066             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
rmu:RMDY18_12860 (best score: 191.815)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13066-T1-C
LinkDB
Position
C471165:complement(106..435)
AA seq 109 aa
RQPQYTPYAVEEQVVSIWAGTNGYLDDLEVSDVLRFEAEFIDYLRHRTSVLSDIAASGKL
EDETLDALKTAVADFKKGFRSEGTSHLVDAGHEEHKAAQDRDITQETIG

KEGG   T30302 (Metagenome): 7179
Entry
7179              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase F1, alpha subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
vpr:Vpar_1534 (best score: 164.466)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.7179-T1-C
LinkDB
Position
C457419:complement(1..300)
AA seq 100 aa
HGVYGMVLNLEQDNVGAVLLGNDFLIKEGDEVRRTGRIMQVPVGDGLIGRVVNALGQPID
GKGEIVAETYRPVEYPAPGIADRKSVFEPMQTGLKAIDAM

KEGG   T30302 (Metagenome): 18290
Entry
18290             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
rpne:NCTC8284_00248 (best score: 435.261)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.18290-T1-C
LinkDB
Position
C481533:1..711
AA seq 236 aa
RRPPGREAYPGDVFYLHSRLLERAARVNEEYVEKFTQGAVKGKTGSLTALPIIETQAGDV
SAFVPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGSAQTKVVKKLAGGIRTAL
AQYRELAAFAQFASDLDDATRKQLSHGEKVTELLKQKQYVPLSVAEQSVLLFAVEFGYLE
DVELQKIASFEAALLDYARRNHSEFMAELTKTGNYNDEVKASLKAILDNFKANSAW

KEGG   T30302 (Metagenome): 5153
Entry
5153              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
hin:HI0481 (best score: 291.967)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5153-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4835:complement(282..749)
AA seq 155 aa
LFNSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATR
KQLSHGEKVTELLKQKQFAPLSVAEQAVVLFAVEFGYLDNVELSKIASFETALLDYSNRN
HAEFMQELTKTGNYNDEIKDTLKGILDSFKANSAW

KEGG   T30302 (Metagenome): 1936
Entry
1936              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
paet:NCTC13378_01925 (best score: 315.464)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.1936-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2001:205..699
AA seq 165 aa
MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY
AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGQPIDGKGE
IENDGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRE

KEGG   T30302 (Metagenome): 13661
Entry
13661             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
got:AXE85_07450 (best score: 210.69)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13661-T1-C
LinkDB
Position
C472455:1..357
AA seq 118 aa
LRLDLASYRELESFAQFGSDLDPATREKLERGKRTVEVLKQDLHKPIPVEKQVMILYALT
HGFLDDVEVKDIHRFEQELYSYLDAHENEAVKHIIETKDLPSTEVMDEVIAAFKKTFA

KEGG   T30302 (Metagenome): 7841
Entry
7841              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
spy:SPy_0758 (best score: 180.644)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.7841-T1-C
LinkDB
Position
C458997:2..310
AA seq 103 aa
IKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENAMSGELLIFENGSYGMAQNLESTDV
GIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRP

KEGG   T30302 (Metagenome): 10837
Entry
10837             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
hin:HI0481 (best score: 238.81)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.10837-T1-C
LinkDB
Position
C466054:complement(2..370)
AA seq 123 aa
GLSDVMQGEMIALPGNRYAMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRG
LLGRVVNTLGQPIDGKGEIENDGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRG
QRE

KEGG   T30302 (Metagenome): 11509
Entry
11509             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
rmu:RMDY18_12860 (best score: 241.506)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.11509-T1-C
LinkDB
Position
C467608:1..390
AA seq 130 aa
DLGPIKDEGRRALELQAPGVTQRKSVHEPLQTGLKAIDAMIPIGRGQRQLIIGDRQTGKT
AIAVDTILNQKANWETGDPSKQVRCVYVAVGQKASTIAAVRHTLETRGALEYTTIVAAPA
SDAAGFKYLA

KEGG   T30302 (Metagenome): 8102
Entry
8102              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
rmu:RMDY18_12860 (best score: 196.823)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.8102-T1-C
LinkDB
Position
C459628:3..314
AA seq 104 aa
GSMTGFPIIETKANDVSAFIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGAA
QTKAMKKVSGTLKLDLAQYRAMEAFAMFASDLDDASKAQLTRGA

KEGG   T30302 (Metagenome): 5354
Entry
5354              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
got:AXE85_07450 (best score: 296.204)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5354-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4985:complement(3..464)
AA seq 154 aa
AEEISSLLKSQIENYQFEVKSTDVGTVIEVGDGIARVYGLNEIMSGELVEFTKTGVMGLA
QNLEDTNVGIVILGPTTDIKEGDEVRRTGRVMDVPVGEELIGRVVDPLGQPVDGRGPVNT
TKRRPIESPAVGVMGRKSVSVPFQTGIKAIDALV

KEGG   T30302 (Metagenome): 8391
Entry
8391              CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
acq:AM609_02610 (best score: 189.889)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.8391-T1-C
LinkDB
Position
C460296:complement(3..320)
AA seq 106 aa
AAQVKAMKKVAGTLKITLAQYRSMQAFAMFASDLDAATRAQLTRGERLMELLKQPQYTPY
PVAEQVASVWAGTKGYLDDIDVSDVLPFEAAFLDHLRRNTDILDTI

KEGG   T30302 (Metagenome): 371
Entry
371               CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha (fragment)
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
spy:SPy_0758 (best score: 232.646)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.371-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_454:complement(3..371)
AA seq 123 aa
EAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKGQ
DMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEF
MYQ

KEGG   T30302 (Metagenome): 15491
Entry
15491             CDS       T30302                                 

Gene name
atpA
Definition
ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Best hit
spy:SPy_0758 (best score: 233.032)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.15491-T1-C
LinkDB
Position
C476291:1..453
AA seq 150 aa
GIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLN
RGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEI
LETIRDTKDLPEEAVLDAAITEFLNQTSFQ

DBGET integrated database retrieval system