KEGG   T30302 (Metagenome): 13122
Entry
13122             CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1122 (best score: 162.155)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.13122-T1-C
LinkDB
Position
C471289:199..438
AA seq 80 aa
MKNEMLALILAGGQGTRLGKLTQSIAKPAVQFGGRYRIIDFALSNCANSGIHNVGVITQY
QPLALNSHIGNGSSWGLDGI

KEGG   T30302 (Metagenome): 14771
Entry
14771             CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1122 (best score: 309.301)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.14771-T1-C
LinkDB
Position
C474747:3..506
AA seq 168 aa
MNTDANNRIVEFEEKPENPKSTKASMGIYIFDWQRLRNMLVAAENSNVDMSDFGKNVIPN
YLESGESVYAYEFAGYWKDVGTVESLWEANMEYINPENALDSRNRRWKIYSRNLISPPNF
LSENAKVEDSLVVDGCFVDGTVKHSILSTGAQVRKDAVIEDSVIMSGA

KEGG   T30302 (Metagenome): 15591
Entry
15591             CDS       T30302                                 

Gene name
glgD
Definition
glucose-1-phosphate adenylyltransferase, glgD subunit
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1123 (best score: 285.419)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.15591-T1-C
LinkDB
Position
C476501:3..548
AA seq 182 aa
VVYKKLHKENISEVNSVLNIDETDHVRGHKLFDEREDAELFNMSTDIFVVDTPWLIEKLE
EEAKKEHPQKLRYVLRDLAVEEGAFAYEYTGYLANIHSVATYYQANLDMLESKKFYSLFS
PNQKIYTKVKNEEPTYYAPSSKVSRAQFASGSIVEGEVDNSVISRNTNIKAGSQVKNSIL
FP

KEGG   T30302 (Metagenome): 17172
Entry
17172             CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
hin:HI1359 (best score: 190.66)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.17172-T1-C
LinkDB
Position
C479569:356..649
AA seq 98 aa
MKAGDLNKYDLVKNTLVLILAGGRGSRLHELTDKRAKPALYFGGNRRIIDFALSNCINSG
LNRIGVVTQYAAHSLLRHLQTGWSFLPQEKGEFVDMLP

KEGG   T30302 (Metagenome): 3380
Entry
3380              CDS       T30302                                 

Gene name
glgD
Definition
glucose-1-phosphate adenylyltransferase, glgD subunit
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
got:AXE85_04270 (best score: 520.005)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.3380-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3385:complement(3..1043)
AA seq 347 aa
MVNAFCVLFADNYRNDDLQGLVRNRTLASLAVASRYRMIDFMLSSLVKAEVSNIAVVTNY
HYKSLMDHLSWGKDWDLNRKNSGLKFITPMSNHHSNRVAQNKIEALGDASKYADTLLEEY
CILADGNIVGNIDFKDMVKYHKTINADITLAYTYRKPQQRESQIIFDDKNRVYDSLYHYD
GFEQVCPTQVKIYVMSKQMFKELVKKGTTLGWQDLLLDFITKNFHRLNVYGYEIKNYNRT
INSVQEYYNFNRDLLNPDKLNELFLSGTDILTRVADSVPTTYGDGAIVKNSILGDGCEIN
GIVESSILFRDVVVEEGAVIKNSIVLPNCVIKKSAYLDCVILDKYAV

KEGG   T30302 (Metagenome): 3381
Entry
3381              CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
got:AXE85_04265 (best score: 277.715)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.3381-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3385:complement(1045..1566)
AA seq 173 aa
KDFGKNIIPMMLNEGKNIYAYPFYGYWKDVGTIESLWEANMDLIKNKENFNIDDRLWRIY
YRHEGAMPQYLGHSANVKNSMISDGTAVYGTVSESIISSGVRIEEGAEIVGSIIMKDVLI
EKGAKVYNSIIAEGSIVKENVEVGHRDITLGKEQITVIGRDEVVKDNRKVEGK

KEGG   T30302 (Metagenome): 4284
Entry
4284              CDS       T30302                                 

Gene name
glgD
Definition
glucose-1-phosphate adenylyltransferase, glgD subunit
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1123 (best score: 283.493)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.4284-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4144:complement(2..454)
AA seq 151 aa
LPFGGKYRLIDFPLSSLANAGVRSIFGIFQQDNISSVFDHIRSGREWGLSTLLSHYYLGI
YNTRVESSTVGKEYYQQLLTYLKRSGSNQTVALNCDVLINIDLNQVFHLHSTTKGPITVV
YKKLAKKDISEVNAILEVDETDHFVLINSLI

KEGG   T30302 (Metagenome): 5555
Entry
5555              CDS       T30302                                 

Gene name
glgD
Definition
glucose-1-phosphate adenylyltransferase, glgD subunit
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1123 (best score: 361.303)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.5555-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5134:complement(3..572)
AA seq 190 aa
FHDMSTLTDHRPVASLPFGGKYRLIDFPLSSLANAGVRSVFGIFQQDNISSVFDHIRSGR
EWGLSTLLSHYYLGIYNTRVESSTVGKEYYQQLLTYLKRSGSNQTVSLNCDVLINIDLNQ
VFHLHNTTKGPITVVYKKLPKKDISEVNAILEVDETDHVRSHTLFDRKSTEEMFNMSTDI
FVIDTPWLIE

KEGG   T30302 (Metagenome): 7809
Entry
7809              CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
got:AXE85_04265 (best score: 184.111)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.7809-T1-C
LinkDB
Position
C458933:3..311
AA seq 103 aa
KDFGKNIIPMMLNEGKNIYAYPFYGYWKDVGTIESLWEANMDLIKNKENFNIDDRLWRIY
YRHEGAMPQYLGHSANVKNSMISDGTAVYGAVSESIISSGVRI

KEGG   T30302 (Metagenome): 8509
Entry
8509              CDS       T30302                                 

Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
spn:SP_1123 (best score: 129.028)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.8509-T1-C
LinkDB
Position
C460614:133..324
AA seq 64 aa
MKIDKYSAILGNTVGFHDMSTLTDHRPVASLPFGGKYRLIDFPLSSLANAGIRSIFGIFQ
QDNI

KEGG   T30302 (Metagenome): 9176
Entry
9176              CDS       T30302                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Best hit
got:AXE85_04265 (best score: 235.343)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.9176-T1-C
LinkDB
Position
C462166:3..335
AA seq 111 aa
FGGKYRIIDFPLSNCANSGISTVGVLTQFMPLELNSYMGNGQPWDLDRMDGGLSILPPYT
AGKTGEWYKGTANAIYQNIKYIEQYNPEYVLILSGDHIYKMNYKEMLDFHK

DBGET integrated database retrieval system