KEGG   T30302 (Metagenome): 13128
Entry
13128             CDS       T30302                                 

Gene name
lpxA
Definition
acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Best hit
hin:HI1061 (best score: 112.849)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
01503  Cationic antimicrobial peptide (CAMP) resistance
Other DBs
HMP: SRS016196.13128-T1-C
LinkDB
Position
C471299:complement(264..437)
AA seq 57 aa
GFDKPTMHAIRNVYKMIYRSGKTLEEVLPEIEQIAETDSAISFFVEFFKRSTRGIIR

KEGG   T30302 (Metagenome): 5611
Entry
5611              CDS       T30302                                 

Gene name
lpxA
Definition
acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Best hit
rpne:NCTC8284_03742 (best score: 498.434)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
01503  Cationic antimicrobial peptide (CAMP) resistance
Other DBs
HMP: SRS016196.5611-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5172:complement(72..860)
AA seq 262 aa
MIHPSAKIHPTALVADGAVIGEDVVIGPFCIIEGSVEIKARTVLNSHIVVKGDTVIGEDN
QIYQFASIGEVNQDLKYKGEATKTIIGNGNRIREHVTIHRGTIQGGGVTRIGNNNLLMVN
VHVAHDCQIKNNCILANNATLAGHVELDDFVIVGGMSAIHQFVIVGAHVMLGGGSMVSQD
VPPYVMAQGNHAQPFGVNLEGLKRRGFDKPTMHAIRNVYKMIYRSGKTLEEVLPEIEQIA
QTESAISFFVEFFKRSTRGIIR

KEGG   T30302 (Metagenome): 18907
Entry
18907             CDS       T30302                                 

Gene name
lpxA
Definition
acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Best hit
rpne:NCTC8284_03742 (best score: 399.823)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
01503  Cationic antimicrobial peptide (CAMP) resistance
Other DBs
HMP: SRS016196.18907-T1-C
LinkDB
Position
C482609:194..820
AA seq 209 aa
MIHPNAKIHPTALVEEGAVIGEGVVIGPFCIVEGTVEIKARTVLKSHVVVRGDTVIGEDN
EIYQFASIGEVNQDLKYNGEATKTIIGNGNRIREHVTIHRGTIQGGGVTSIGNNNLLMVN
VHIAHDCQIKNNCILANNATLAGHVELDDFVIVGGMSAIHQFVIVGAHVMLGGGSMVSQD
VPPYVMAQGNHARPFGVNLEGLKRRGFDK

DBGET integrated database retrieval system