KEGG   T30302 (Metagenome): 13188
Entry
13188             CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
vpr:Vpar_0813 (best score: 161.77)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13188-T1-C
LinkDB
Position
C471427:complement(3..440)
AA seq 146 aa
IIDADALIILSDIEGLYTANPSTDPNATLIHEVEALTPYIYEISGGAGSSLGTGGMYTKI
QAAHIATNSGVHMIIASGDHPDSIKAIMNGEERGTHFWPHRDVPQIKKRWMAFGTRLQGT
IHVDKGCRDALLTNGSSVLPVGILSG

KEGG   T30302 (Metagenome): 21891
Entry
21891             CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
rpne:NCTC8284_03660 (best score: 192.2)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21891-T1-C
LinkDB
Position
C486981:complement(2..298)
AA seq 99 aa
MTKKTIVVKFGTSTLTQGTPKLNSPHMMEIVRQIAQLHHDGFRIVIVTSGAIAAGRHYLN
HPSLPPTIASKQLLAAVGQSQLIQAWERLFAIYDIHIGQ

KEGG   T30302 (Metagenome): 22518
Entry
22518             CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
hin:HI0900 (best score: 184.496)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.22518-T1-C
LinkDB
Position
C487649:1608..1910
AA seq 101 aa
MSANRKTIVVKFGTSTLTHGSPKLNAPHMVDIVRQIAQLHQAGFRVVIVTSGAIAAGRHY
LNHPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQ

KEGG   T30302 (Metagenome): 5396
Entry
5396              CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
nme:NMB1069 (best score: 86.2705)
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5396-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5016:complement(3..155)
AA seq 51 aa
MLHEAGHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEY

KEGG   T30302 (Metagenome): 6370
Entry
6370              CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
hin:HI0900 (best score: 471.085)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6370-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5636:complement(150..977)
AA seq 275 aa
YDIHIGQILLTRADIEDRERFLNARDTLHALLDNHIIPVINENDAVATAEIKVGDNDNLS
ALVAILVQAEQLYLLTDQQGLYESDPRKNPDAKLIPVVEQITDHIRSIAGGSGTNLGTGG
MSTKIIAADVATRSGIETIIAPGSRSDVIVDLAYDKPIGTKFIAHHSDRLESRKQWLFAA
PSAGMLMIDEGAENAMLVQNKSLLPAGITAVEGRFSRGEVVKIKNTSGKVIALGMPRYNS
DALELIKGKKSQDIEQILGYEYGAVALHRDDMIVL

KEGG   T30302 (Metagenome): 6686
Entry
6686              CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
hin:HI0900 (best score: 385.571)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6686-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5794:complement(528..1235)
AA seq 235 aa
NDNLSALVAILVQAEQLYLLTDQQGLFDSDPRKNPDAKLIPIIEQITDHIRAIAGDSGTN
LGTGGMMTKIIAADVATRSGIETIIAPGNQPNVIADLAYDHNIGTKFIAHQSDRLESRKQ
WLFAAPSVGIITIDDGAEHAMLIQNKSLLPAGIIAIEGCFSRGEVVKIRTQSGKDIALGM
PRYNSDALQLIKGKKSTEIEFILGYEYGSVAMHRDDLIXXXXXXXXXXXKCGFFT

KEGG   T30302 (Metagenome): 8062
Entry
8062              CDS       T30302                                 

Gene name
proB
Definition
glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Best hit
nme:NMB1069 (best score: 154.836)
Taxonomy
Betaproteobacteria [GN:nme]
Pathway
00330  Arginine and proline metabolism
00332  Carbapenem biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8062-T1-C
LinkDB
Position
C459516:complement(3..314)
AA seq 104 aa
SLGFKKRPTKVADKQASAAVGQGLLLEEYTTNLLLKQIISAQILLTQDDFADKRRYKNAH
QALSVLLNRGAIPIINENDSVAIEELKVGDNDTLSAQVAAMVQA

DBGET integrated database retrieval system