KEGG   T30302 (Metagenome): 13215
Entry
13215             CDS       T30302                                 

Gene name
ilvC
Definition
acetohydroxy acid isomeroreductase, catalytic domain
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
hin:HI0682 (best score: 294.664)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13215-T1-C
LinkDB
Position
C471495:complement(2..442)
AA seq 147 aa
QIKESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWREATGKTAFENAPKYDGKIS
EQEYFDNGVLMIAMVKAGVELAFEAMVASGIYEESAYYESLHELPLIANTIARKRLYEMN
VVISDTAEYGNYLFSNVATPILAKEII

KEGG   T30302 (Metagenome): 14799
Entry
14799             CDS       T30302                                 

Gene name
ilvC
Definition
ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
rmu:RMDY18_07530 (best score: 222.631)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14799-T1-C
LinkDB
Position
C474815:131..508
AA seq 126 aa
MAATIFYNDDADLAPVQGRTVAIIGYGSQGHAHALNLRDSGVKVIVGLSEGSKSRAKAEA
EGLRVATVAEAAAEADLIMILTPDQVQAQVYKESIEPNLKPGDALFFAHGFNIHFGYITV
PEGVDV

KEGG   T30302 (Metagenome): 17338
Entry
17338             CDS       T30302                                 

Gene name
ilvC
Definition
ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
fhw:RN87_02020 (best score: 204.912)
Taxonomy
Fusobacteria [GN:fhw]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17338-T1-C
LinkDB
Position
C479871:311..664
AA seq 118 aa
MAGNILGTQVFYDADCNLQALVGKKITVLGYGSQGHAHALNLKESGMDVQIGLREGSKSW
KEAEEAGFVVKETGDAVKGADVVMILIPDELQAETYEKSIAPNLKKGAYLAFAHGFNI

KEGG   T30302 (Metagenome): 5202
Entry
5202              CDS       T30302                                 

Gene name
ilvC
Definition
ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
hin:HI0682 (best score: 271.937)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5202-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4874:complement(2..403)
AA seq 134 aa
NMRDSGLDISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDKQHSKV
VADVMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTL
IAVHPENDPKGEGM

KEGG   T30302 (Metagenome): 12111
Entry
12111             CDS       T30302                                 

Gene name
ilvC
Definition
acetohydroxy acid isomeroreductase, catalytic domain
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
rmu:RMDY18_07530 (best score: 254.988)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12111-T1-C
LinkDB
Position
C469035:complement(2..406)
AA seq 135 aa
GVDVAMVAPKGPGHTVRREYEAGRGVPALVAVEKDPSGKALDLALSYAKALGATRAGVIK
TTFTEETESDLFGEQAVLCGSLSQLVQYGFEVLTEAGYQPEIAYFEVLHELKLIVDLMIE
GGIAKQRWSISDTAE

KEGG   T30302 (Metagenome): 10080
Entry
10080             CDS       T30302                                 

Gene name
ilvC
Definition
acetohydroxy acid isomeroreductase, catalytic domain
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
hin:HI0682 (best score: 227.254)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10080-T1-C
LinkDB
Position
C464338:1..354
AA seq 118 aa
NDPKGEGMAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQTILCGMLQAGSIVCYDKL
VADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQIKESLGF

KEGG   T30302 (Metagenome): 17240
Entry
17240             CDS       T30302                                 

Gene name
ilvC
Definition
acetohydroxy acid isomeroreductase, catalytic domain
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Best hit
lba:Lebu_1703 (best score: 305.064)
Taxonomy
Fusobacteria [GN:lba]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17240-T1-C
LinkDB
Position
C479697:complement(87..656)
AA seq 189 aa
QEGSGVPCLYAVYADPSGDTKEVALAWASGVGGGRSGILETDFRQETETDLFGEQAVLCG
GVCALMQTGFEVLVEAGYNPVNAYFECVHEMKLIIDLIYEGGFETMRKSISNTAEFGDYI
TGPKVIPASAKEAMRGVLKDIQDGKFADQFLGDYAAGYPYLNEQRKQSAAHQVEEVGGEL
RKLMPWIKK

DBGET integrated database retrieval system