KEGG   T30302 (Metagenome): 13363
Entry
13363             CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
hin:HI1743 (best score: 105.145)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13363-T1-C
LinkDB
Position
C471805:complement(2..181)
AA seq 60 aa
MSQGNLYILSAPSGAGKSSLISALLASDSSTQKMVSVSHTTRAPRPGEVEGVHYYFVSKE

KEGG   T30302 (Metagenome): 14124
Entry
14124             CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
rmu:RMDY18_09980 (best score: 264.233)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14124-T1-C
LinkDB
Position
C473393:1..462
AA seq 153 aa
ATTRDPRPGEEEGVHYYFVSHEEFDQMIADGQMLEYAVVHGKNKYGTPRAKVQEALNAGR
PVILEIDLQGARQIRESMPEAQLIFLAPPSWDELVSRLVGRGTESEQEQQRRLETAKIEL
ESESEFDVTVVNDSVERAAQEIAHIVGAESAEA

KEGG   T30302 (Metagenome): 21127
Entry
21127             CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
vpr:Vpar_0841 (best score: 292.352)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.21127-T1-C
LinkDB
Position
C485999:complement(2..529)
AA seq 176 aa
MSDKGILIVISGPSGAGKGTICAELRKQMPNLVYSVSMTTRQPRVGEEEGISYFFRDVDT
FEKLIKEDAFLEYAKVYDNYYGTPKEHVMNLLEEGKSVILEIDIQGAMKVKESYSDAVFI
YVVPPSLDVLTSRLHGRGTDDKEVIHKRLSLACSELALAHRYDYIVVNDDLEDAIE

KEGG   T30302 (Metagenome): 22475
Entry
22475             CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
hin:HI1743 (best score: 345.895)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.22475-T1-C
LinkDB
Position
C487611:complement(237..863)
AA seq 208 aa
MSQGNLYILSAPSGAGKSSLISALLEKNQGTKKMVSISHTTRPPRPGESHGVHYYFVSVE
EFETLIEKGHFLEYAKVFGGNYYGTSLPAIEENLAKGIDVFLDIDWQGAQQIRQKVPSVK
SIFILPPSLPELERRLVGRGQDSKEVIAERMSKAISEISHYDEYDYVIVNDNFEQALADL
QSILQAERLTKAYQQTENADLIHQLLAK

KEGG   T30302 (Metagenome): 5419
Entry
5419              CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
spy:SPy_1632 (best score: 72.0182)
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5419-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5040:complement(69..218)
AA seq 49 aa
MREYDYAIVNDQVPLAAERVKRVIEAEHFRVDRVIGHYQEMLPKSPTTR

KEGG   T30302 (Metagenome): 5420
Entry
5420              CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
spy:SPy_1632 (best score: 231.876)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5420-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5040:complement(211..636)
AA seq 141 aa
MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTRE
EFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLXXXXXXXXNCPHA

KEGG   T30302 (Metagenome): 68
Entry
68                CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
got:AXE85_03795 (best score: 392.119)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.68-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_118:100..720
AA seq 206 aa
MEKGLLIVLSGPSGVGKGTVRKRIFESNDVDFEYSISMTSRGMRPGEVDGVDYFFKTKEE
FESLIQQGELLEYAQYVDNYYGTPVKYVRETMEKGKDIFLEIEVQGAGQVKSKIPDALFI
FLAPPSIGDLKERLKGRGTESDEVIESRIAKAKKEINMMHLYDYVVENDEVDKAVERIKA
IILSEHLKRERIEMKYRRALLELEEM

KEGG   T30302 (Metagenome): 9366
Entry
9366              CDS       T30302                                 

Gene name
gmk
Definition
guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Best hit
spy:SPy_1632 (best score: 210.305)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016196.9366-T1-C
LinkDB
Position
C462612:complement(2..340)
AA seq 113 aa
GEVDGVDYFFRTREEFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQ
GALQVKKKVPDAVFIFLTPPDLEELQDRLVGRGTDSSDVIAKRIEKAKEEIAL

DBGET integrated database retrieval system