KEGG   T30302 (Metagenome): 14157
Entry
14157             CDS       T30302                                 

Definition
hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S
type
  KO
K01677  fumarate hydratase subunit alpha [EC:4.2.1.2]
Best hit
vpr:Vpar_1529 (best score: 258.07)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.14157-T1-C
LinkDB
Position
C473465:3..479
AA seq 159 aa
FNRVNTKNNTPAVIYTKIVPGDKVDINVELKGFGSENKSGVKMLVPADGVEGVKKAVLEI
VKKAGPNPCPPMVLGIGIGGTMDYAAFLSKKALLRSVEERNAHPEYAKLEEEINAMVNKT
GIGPQLGGSTTAVSVNIEWAATHIAGLPVAVTICCHASR

KEGG   T30302 (Metagenome): 7528
Entry
7528              CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
aap:NT05HA_1233 (best score: 200.675)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.7528-T1-C
LinkDB
Position
C458257:3..305
AA seq 101 aa
VNEVVANRAHVLHGGKLGEKSFIHPNDDVNKSQSSNDTFPTAMHIAAYKKVVEHTIPCVE
RLQKTFAQKSAAFKDVVKIGRTHLMDATPLTLGQEFSAYAA

KEGG   T30302 (Metagenome): 19272
Entry
19272             CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
aap:NT05HA_1233 (best score: 377.481)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.19272-T1-C
LinkDB
Position
C483207:1..570
AA seq 189 aa
ETHGAIKQLAMSLFKIANDIRLLASGPRSGIGEILIPENEPGSSIMPGKVNPTQCEALTM
VCAQVFGNDTTIAFVGSQGHFQLNVFNPVMVANFLQSAQLLGDACVSFDEHCAIGIEPNY
PRIKQQLENSLMLVTALNTHIGYENAAKIAKTAHKNGTTLREEAINLGLVSAEDFDKWVR
PEDMVGSLK

KEGG   T30302 (Metagenome): 21351
Entry
21351             CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
rmu:RMDY18_16160 (best score: 761.525)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.21351-T1-C
LinkDB
Position
C486309:complement(71..1306)
AA seq 411 aa
AATANEELQVLDAERAQAIREAADLVATGEYDEHFPIDVFQTGSGTSSNMNTNEVLATLA
TRSLESRGIEVHPNDHVNASQSSNDVFPTSVHVAVTEALVKELIPSLEVLAASLEKKSAE
FKDVVKSGRTHLMDATPITLGQEFSGYAATVRYGIERVNASLPRVAEVPLGGTAVGTGIN
TPAGFSARVIELLAEETGLPLTEARNHFEAQANRDGLVEVSGQLRTLAYGLMKISNDIRW
MGSGPNTGLGELHIPDLQPGSSIMPGKVNPVICEATIQVAAQVIGNDATIALSSTNGAFE
LNVGIPVMAANLLQSIRLLANVSRVAAEKMIDGLSANVERCRFLAEASPSTVTPLNKLIG
YEAAAKIAKYSVANKVTVRDAVVALGYVERGEVTEAQLDEALDVTKMLGNF

KEGG   T30302 (Metagenome): 7608
Entry
7608              CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
rpne:NCTC8284_02867 (best score: 210.305)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.7608-T1-C
LinkDB
Position
C458433:3..308
AA seq 102 aa
SIMPGKVNPTQCEAMTMVCAQVFGNDTTIAFVGSQGHFQLNVFNPVMIANFLQSAQLLGD
ACVSFDEHCTVGIEPNYPRIKQQLENSLMLVTALNTHIGYEN

KEGG   T30302 (Metagenome): 17050
Entry
17050             CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
hin:HI1398 (best score: 373.629)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.17050-T1-C
LinkDB
Position
C479331:complement(1..567)
AA seq 189 aa
MAFRIEKDTMGEVQVPADKYWAAQTERSRNNFKIGPAESMPHEIIEAFGYLKKAAAFANH
DLGVLPLEKRDLIAQACDEILANKLDDQFPLVIWQTGSGTQSNMNVNEVVANRAHVLNGG
KLGEKSIIHPNDDVNKSQSSNDTFPTAMHIAAYKKVVEHTIPCVERLQKTFAAKSEAFKN
VVKIGRTHL

KEGG   T30302 (Metagenome): 15438
Entry
15438             CDS       T30302                                 

Gene name
fumC
Definition
fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Best hit
rpne:NCTC8284_02867 hin:HI1398 aap:NT05HA_1233 (best score: 108.612)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00020  Citrate cycle (TCA cycle)
00620  Pyruvate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04934  Cushing syndrome
05200  Pathways in cancer
05211  Renal cell carcinoma
Other DBs
HMP: SRS016196.15438-T1-C
LinkDB
Position
C476175:complement(384..542)
AA seq 52 aa
NTHIGYENAAKIAKTAHKNGTTLREEAINLGLVSAEDFDKWVRPEDMVGSLK

DBGET integrated database retrieval system