KEGG   T30302 (Metagenome): 14295
Entry
14295             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
vpr:Vpar_0141 (best score: 207.994)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14295-T1-C
LinkDB
Position
C473769:3..485
AA seq 161 aa
GAQLILTPKELGMKGALGKAQEILDNYPNAVTLGQFVNPANPHAHYETTAKEILRDVPNV
GIFVAGIGTGGTFTGVTKALKEQHPYIKAVAVEPEGSPVISRGTGGVHKIQGIGAGFIPE
NFDSSLMDEVQTVTDEDAIEEVANFMRETGIGIGISSAAAI

KEGG   T30302 (Metagenome): 8351
Entry
8351              CDS       T30302                                 

Definition
hypothetical protein
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
vpr:Vpar_0141 (best score: 165.622)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8351-T1-C
LinkDB
Position
C460214:complement(2..319)
AA seq 106 aa
KNAIDLIGNTPIYRIPDTNVYVKLEKYNAGGSVKDRAVLGMLQDAQEKGLIKNDTIIVEA
TSGNTGIALAMLGAMLSIKTIIIMPESMSKERRELIKAYGAQLILT

KEGG   T30302 (Metagenome): 23108
Entry
23108             CDS       T30302                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
hin:HI1103 (best score: 274.633)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.23108-T1-C
LinkDB
Position
C488261:2848..3297
AA seq 150 aa
MTIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSFSVKCRIGANMIWQAEKDGILT
AGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLRGLGVNLVLTEGSKGM
KGAIAKAEEIVASNPNHYVMLKQFENPANP

KEGG   T30302 (Metagenome): 1705
Entry
1705              CDS       T30302                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
got:AXE85_08020 (best score: 368.237)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1705-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1776:3..704
AA seq 233 aa
AVAILASVLGIKAVVIMPESMSIERRNIIKAYGAQLILTPKEQGIKGSIEKAASIREKYS
NAISLSQFDNPANPAYHHKTTGREILEQVPNIDVFVAGVGTGGTFTGVARYLKEQKPEVV
TVAVEPAESPAISEGRGGVHKIQGIGTGFIPENFRKEYMDEILTVTSEEAIEETKNFLRS
TGIGIGISSGAAIVGAKKAAKKYPDKNIVTILPDGVDKYLSVLDFEDVTHVEV

KEGG   T30302 (Metagenome): 21883
Entry
21883             CDS       T30302                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
aap:NT05HA_2334 (best score: 259.996)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21883-T1-C
LinkDB
Position
C486967:2..508
AA seq 168 aa
NPDIHRQTTGEEIWKDTEGKVDVVVAGVGTGGTITGISRAIKLDHGKKITSVAVEPTESP
VISQTLAGQEVKPGPHKIQGIGAGFIPKNLDLSLIDRVETVDSDTAIATARRLMAEEGIL
AGISSGAAVAAADRLAKLPEFQNKLIVAILPSASERYLSTALFEGIEA

KEGG   T30302 (Metagenome): 14686
Entry
14686             CDS       T30302                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
got:AXE85_08020 (best score: 155.992)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14686-T1-C
LinkDB
Position
C474589:2..283
AA seq 93 aa
KIQGIGTGFIPENFRKEYMDDVYTVTSEEAIEETKNFLRSTGIGIGISSGAAIVGAKKAA
EKYPGKNIVTILPDGVDKYLSVLDFEDVTHVEV

KEGG   T30302 (Metagenome): 21909
Entry
21909             CDS       T30302                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
hin:HI1103 (best score: 187.193)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21909-T1-C
LinkDB
Position
C486999:complement(2..280)
AA seq 93 aa
MTIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGALT
KGKEIVDATSGNTGIALAYVAAARGYKITLTMP

KEGG   T30302 (Metagenome): 7845
Entry
7845              CDS       T30302                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
spy:SPy_1618 (best score: 160.999)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7845-T1-C
LinkDB
Position
C459003:1..312
AA seq 104 aa
SVKDRIALSMIEKAEQDGILKPGSTIVEATSGNTGIGLSWVGAAKGYKVVIVMPETMSVE
RRKIIQAYGAELVLTPGSEGMKGAIAKAQEIAAERDGFLPLQFD

KEGG   T30302 (Metagenome): 14899
Entry
14899             CDS       T30302                                 

Gene name
srpG
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
rmu:RMDY18_07950 (best score: 201.06)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14899-T1-C
LinkDB
Position
C475037:178..513
AA seq 112 aa
VAEIVNSIVDAIGQTPLVRLNRLDAGLPGNVAVKLEFYNPAGSVKDRIGRAIIDAAEEAG
ALKPGGTIVEGTSGNTGIALAMVGAARGYNVILTMPETMSAERRVLLRAYGA

KEGG   T30302 (Metagenome): 20435
Entry
20435             CDS       T30302                                 

Gene name
cysK
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
hin:HI1103 (best score: 234.958)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.20435-T1-C
LinkDB
Position
C485023:complement(639..1058)
AA seq 139 aa
TGGTITGISRAIKLDFGKQITSVAVEPVESPVITQTLAGEEAKPGPHKIQGIGAGFIPKN
LDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRIAKLPEFKDKLVVAI
LPSASERYLSTALFEGIEG

KEGG   T30302 (Metagenome): 9226
Entry
9226              CDS       T30302                                 

Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
spy:SPy_1618 (best score: 172.17)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9226-T1-C
LinkDB
Position
C462280:complement(3..335)
AA seq 111 aa
TIVEATSGNTGIGLSWVGAAKGYKVVIVMPETMSVERRKIIQAYGAELVLTPGSEGMKGA
IAKAEEIAEERNAWLPLQFNNPANPEVHERTTGVEILAAFGDTGLDAFVGG

KEGG   T30302 (Metagenome): 7138
Entry
7138              CDS       T30302                                 

Gene name
srpG
Definition
cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Best hit
rmu:RMDY18_07950 (best score: 166.392)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7138-T1-C
LinkDB
Position
C457301:complement(17..301)
AA seq 94 aa
PHKIQGLGANFVPDTLDREIYDSVIAVSGEEAIRTSRALATQEGILGGISSGAAVYAALE
EAKKSENKDKLIVAVVPDFGERYISTVLYEDIRG

DBGET integrated database retrieval system