KEGG   T30302 (Metagenome): 14668
Entry
14668             CDS       T30302                                 

Gene name
accC
Definition
biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
rhey:FEE42_05910 (best score: 311.612)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.14668-T1-C
LinkDB
Position
C474553:complement(1..501)
AA seq 167 aa
LLADETVCIGPAPSVKSYLNIPAIIAAAEVTGADAIHPGYGFLSENADFAEQVERSGFIF
IGPTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGPVGSDIAKNKEIAKRIGYPIIIKASG
GGGGRGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRH

KEGG   T30302 (Metagenome): 15070
Entry
15070             CDS       T30302                                 

Definition
biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 326.635)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.15070-T1-C
LinkDB
Position
C475397:3..521
AA seq 173 aa
AVHSTADRDLKHVLLADETVCIGPAPSAKSYLNIPAIIAAAEVTGADAIHPGYGFLSENA
DFAEQVERSGFTFIGPTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGPVSNDISKNKEIA
KRIGYPIIIKASGGGGGRGMRVVRSEGALEESIAMTKAEAKAAFNNDMVYMEK

KEGG   T30302 (Metagenome): 1836
Entry
1836              CDS       T30302                                 

Definition
biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 157.147)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.1836-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1902:1..276
AA seq 91 aa
GVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFDALMKMQRALYELEIEGVQTNADFQ
LDLISDRNVIAGDYDTSFLMETFLPKYQEKE

KEGG   T30302 (Metagenome): 21429
Entry
21429             CDS       T30302                                 

Definition
acetyl-coA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 199.519)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.21429-T1-C
LinkDB
Position
C486413:1..291
AA seq 96 aa
KVNHLHSPGGLGVRWDSHVYGGYTVPPHYDSMIAKLITYGDTREVAIRRMQNALSETIID
GIKTNIPLHELILEDENFQKGGTNIHYLEKKLGMHD

KEGG   T30302 (Metagenome): 22016
Entry
22016             CDS       T30302                                 

Definition
acetyl-coA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
hin:HI0972 (best score: 322.783)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.22016-T1-C
LinkDB
Position
C487111:3..500
AA seq 165 aa
FYFIEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGLPLSYKQEDIKVKGHAMECRINAED
PKTFLPSPGKVAHLHSPGGLGVRWDSHVYAGYTVPSHYDSMIAKLITYGDTRDVAIRRMQ
NALSETIIDGIKTNIPLHELILEDENFQKGGANIHYLEKKLGMYD

KEGG   T30302 (Metagenome): 8313
Entry
8313              CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 120.938)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.8313-T1-C
LinkDB
Position
C460126:complement(2..208)
AA seq 69 aa
MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLADEAICIGPAKSTDSY
LNMNAVLSA

KEGG   T30302 (Metagenome): 9045
Entry
9045              CDS       T30302                                 

Definition
acetyl-coA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 166.007)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.9045-T1-C
LinkDB
Position
C461858:1..333
AA seq 111 aa
PGFGFLSENSKFATMCEEVGVKFIGPSGAIMDMMGDKINARAQMIKANVPVIPGSDGEVF
TAEEALEVAEKIGYPVMLKASAGGGGKGIRKVEKAEDLVAAFESASSEAKA

KEGG   T30302 (Metagenome): 968
Entry
968               CDS       T30302                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 115.931)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.968-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1069:1..258
AA seq 85 aa
EALVVAEKIGYPVMLKASAGGGGKGIRKVEKPEDLVSAFETASSEAKANYGNGAMYIERV
IYPARHIEVQILGDXXXXXXKCRNH

DBGET integrated database retrieval system