KEGG   T30302 (Metagenome): 14674
Entry
14674             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
got:AXE85_07460 (best score: 130.183)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14674-T1-C
LinkDB
Position
C474565:complement(2..232)
AA seq 77 aa
MENLVFLATEHSSHQGFNLGNMAINIVAVLILLVLLKKFAWDKLIDMLDERQKLVEGQLD
DAAKNQKEALVLLEENQ

KEGG   T30302 (Metagenome): 18701
Entry
18701             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
gan:UMN179_01200 (best score: 65.0846)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.18701-T1-C
LinkDB
Position
C482267:complement(2..94)
AA seq 31 aa
VNINATLIGQTIAFIIFVWFCVKFVWPPIIN

KEGG   T30302 (Metagenome): 11768
Entry
11768             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
rmu:RMDY18_12900 (best score: 120.168)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.11768-T1-C
LinkDB
Position
C468215:complement(175..396)
AA seq 73 aa
VEAQRITDNAQKTIEAERLAASVSLRHEVGTLATTLAGKIVGEALDDDERSARVVDRFLA
DLETEQQNAGATR

KEGG   T30302 (Metagenome): 14072
Entry
14072             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase F0, B subunit
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
hin:HI_0483 (best score: 116.316)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14072-T1-C
LinkDB
Position
C473277:complement(276..476)
AA seq 66 aa
KAEAEELKAKIIAQGYAEVEAERKRVQEELRVKVASLAVAGAEKIVGRSIDEAANNDIID
KLVAEL

KEGG   T30302 (Metagenome): 2355
Entry
2355              CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
spy:SPy_0756 (best score: 68.1662)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2355-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2405:complement(111..290)
AA seq 59 aa
MHVTVGELIGNFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEXCERNS

KEGG   T30302 (Metagenome): 19303
Entry
19303             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
puf:UFO1_4263 (best score: 77.7962)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19303-T1-C
LinkDB
Position
C483259:complement(3..188)
AA seq 62 aa
LVDLNGTLVLQILNFIVLVLILAKYAYKPLLQTMEERKRRIENDLTSAEQAREEAAALKA
EY

KEGG   T30302 (Metagenome): 11230
Entry
11230             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase F0, B subunit
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
got:AXE85_07460 (best score: 168.703)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.11230-T1-C
LinkDB
Position
C466954:complement(66..383)
AA seq 105 aa
LVLLEENQEKLKNAQKEIKVMMEEAREQSKIEKQAILEEARKQAEQLKVNAQRDIEDEKK
RALEEINKQIADLSVLVASKILEKELDGSTQSEYVDKVIKEVGVK

KEGG   T30302 (Metagenome): 16582
Entry
16582             CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
rmu:RMDY18_12900 (best score: 108.227)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16582-T1-C
LinkDB
Position
C478399:complement(1..204)
AA seq 68 aa
MTYLAEGGGAEHSSNPLIPNLWELGITVVGFVILYFIVHKYVVPAFEKIYQDRKEAIEGG
LAKAEKAQ

KEGG   T30302 (Metagenome): 8256
Entry
8256              CDS       T30302                                 

Gene name
atpF
Definition
ATP synthase F0, B subunit
  KO
K02109  F-type H+-transporting ATPase subunit b
Best hit
lla:L11208 (best score: 116.316)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.8256-T1-C
LinkDB
Position
C459992:complement(2..319)
AA seq 106 aa
FAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREEALAGSREEAATIVETAKETA
EKNKASILADTTEEVSRLKQKANQEIAQSKADALRSIKGDVADLSI

DBGET integrated database retrieval system