KEGG   T30302 (Metagenome): 14675
Entry
14675             CDS       T30302                                 

Gene name
atpE
Definition
ATP synthase F0, C subunit
  KO
K02110  F-type H+-transporting ATPase subunit c
Best hit
got:AXE85_07465 (best score: 102.064)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14675-T1-C
LinkDB
Position
C474565:complement(286..501)
AA seq 71 aa
MVELIGAGLAAGLAAVGAGIGNGFLFGKFIEGVSRQPELESRLKSNAFVLFALVEAVPIL
AIVISFVILAK

KEGG   T30302 (Metagenome): 2357
Entry
2357              CDS       T30302                                 

Gene name
atpE
Definition
ATP synthase subunit c
  KO
K02110  F-type H+-transporting ATPase subunit c
Best hit
spy:SPy_0754 (best score: 75.8701)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2357-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2405:complement(1050..1214)
AA seq 54 aa
MGVSLGEGMLMNGLLKSVARQPDIIAEFRSLMFLGVAFIEGTFFVTLVFSFIIK

KEGG   T30302 (Metagenome): 16583
Entry
16583             CDS       T30302                                 

Gene name
atpE
Definition
ATP synthase F0, C subunit
  KO
K02110  F-type H+-transporting ATPase subunit c
Best hit
krh:KRH_09790 (best score: 93.2041)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16583-T1-C
LinkDB
Position
C478399:complement(255..446)
AA seq 63 aa
MNVIGYGLAAIGGGIGVGLIFAAYMTSVARQPESQRTLQPMLFMGFAVVEALAILGLVLA
FII

KEGG   T30302 (Metagenome): 19304
Entry
19304             CDS       T30302                                 

Gene name
atpE
Definition
ATP synthase F0, C subunit
  KO
K02110  F-type H+-transporting ATPase subunit c
Best hit
med:MELS_1904 (best score: 79.3369)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19304-T1-C
LinkDB
Position
C483259:complement(218..490)
AA seq 90 aa
MELLLAKAYVLVGSAIGAGLAIGLAAIGAGIGDGLVSGKALEGMTRQPEQSGKLFTNMLI
SVGLIEAVPIIAAVIAIVLVFANPLVDLLK

KEGG   T30302 (Metagenome): 18702
Entry
18702             CDS       T30302                                 

Gene name
atpE
Definition
ATP synthase F0, C subunit
  KO
K02110  F-type H+-transporting ATPase subunit c
Best hit
gan:UMN179_01201 (best score: 141.354)
Taxonomy
Gammaproteobacteria - Others [GN:gan]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.18702-T1-C
LinkDB
Position
C482267:complement(133..387)
AA seq 84 aa
METVISATIIASAIMLAFAALGTAIGFGLLGGKYLESAARQPELANSLLTKMFIVAGLLD
AIAMIAVGIGLYFAFANPFAALLG

DBGET integrated database retrieval system