KEGG   T30302 (Metagenome): 14682
Entry
14682             CDS       T30302                                 

Definition
UPF0735 ACT domain-containing protein CHY_1913
  KO
K06209  chorismate mutase [EC:5.4.99.5]
Best hit
vpr:Vpar_0898 (best score: 120.938)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14682-T1-C
LinkDB
Position
C474583:complement(227..502)
AA seq 91 aa
YVFPFYELSQGKIVSINALISNESGMLSNILRIIADYNGSVLTINQNLPLQGVAHVNISF
ETKELTLPVEDVLHEVRQLEGVIKVELIGQA

KEGG   T30302 (Metagenome): 15755
Entry
15755             CDS       T30302                                 

Definition
UPF0735 ACT domain-containing protein PTH_1602
  KO
K06209  chorismate mutase [EC:5.4.99.5]
Best hit
vpr:Vpar_0898 (best score: 113.235)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15755-T1-C
LinkDB
Position
C476829:362..559
AA seq 66 aa
MAVKGKKDKFYLVNEVILPEAIKKTIKVKSILQLGEAKTINEAVEKMDLSRSAYYKYKDY
VFPFYE

KEGG   T30302 (Metagenome): 6543
Entry
6543              CDS       T30302                                 

Definition
UPF0735 ACT domain-containing protein SSP1116
  KO
K06209  chorismate mutase [EC:5.4.99.5]
Best hit
got:AXE85_02645 (best score: 209.92)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6543-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5729:complement(3..359)
AA seq 119 aa
VDKEKVYYIIREDVLPEAVKKTLAMKKALEEDSKLSILEASKRFDLSRSAFYKYKDTIFP
IQDVKRQSILSLSIDVDDIPGILGKILSVVNEEKCSVLTIHQTVPINAKATIIISLELS

DBGET integrated database retrieval system