KEGG   T30302 (Metagenome): 14839
Entry
14839             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0222 (best score: 349.362)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.14839-T1-C
LinkDB
Position
C474901:complement(1..510)
AA seq 170 aa
LLSQKFKFLRKKDVSPTGHQITEEGGREWENFYRDRWSYDKVVRTTHGVNCTGSCSWNIY
VKNGVVAWENQATDYPKTPDDMPDYEPRGCPRGSTFSWYLYSPLRVKYPYVRGELIELWR
EAKKTAKNPIEAWKSIVEDPEKAKRYKSARGMGGFVRSTWDESTEIVAAS

KEGG   T30302 (Metagenome): 16577
Entry
16577             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 400.593)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.16577-T1-C
LinkDB
Position
C478387:complement(2..607)
AA seq 202 aa
RYISARGKGGLVRSTWAEALEIVAAAHVHTIKYYGPDRCTGFTPIPAMSMVSFSAGVRFI
QLIGGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDASYLIMWGSNIPVTRTPDAHW
VAEVRYRGTKVVSVSPDYADNTKFADEWLPAQAGTDAALAMAMGHVILKENYVDQRVEFF
EDFALTYTDLPFLVTLETREDG

KEGG   T30302 (Metagenome): 17485
Entry
17485             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 419.083)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.17485-T1-C
LinkDB
Position
C480149:complement(3..677)
AA seq 225 aa
AEAAVARGEAKDNADYVAQRLNSGDLEFSVEDVDNPVNWPRTLMLWRSNLFGSSAKGESY
FLKHLVGSMDNVQGADHEESIPREVTWYQEAPQGKLDLLVTSDFRMTTTTLLSDVVLPTA
TWYEKHDISSTDMHPFLHAFSPAIDPPWEARTDHDTFKALSYEFTRQAKKHLGTRKDIVS
VPLLHDTPGQIKQPGGHAPDWKSTPGMSGVPGKNMPNFMTVERDY

KEGG   T30302 (Metagenome): 17645
Entry
17645             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0222 (best score: 431.795)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.17645-T1-C
LinkDB
Position
C480423:complement(2..688)
AA seq 229 aa
PTFNRNYQDLINDARATGAGTEAEINQYIVQALKNKELKFCVEDPSAKENHPRNLFVWRS
NLIGSSSKGHEYFLKYLLGTKNGVLEDEDAPVRPEEINWREAPETGKLDLLIDIDFRMAS
TALYSDIVFPAATWYEKQDLSSTDMHPYVHVFQAAVDCAWDTKSDWDTFRTLAETVSRVA
KESGFTEYEDIVAQPLGHDSPGEVAQPLGKVLDWSKGECEPIPGKTMPN

KEGG   T30302 (Metagenome): 18350
Entry
18350             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0222 (best score: 457.988)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.18350-T1-C
LinkDB
Position
C481633:1..753
AA seq 251 aa
RFLNNQDLGSTEDGADFHTVVIDEITNTVVAPNGTLGDRHTNPKKWNLRLENRATGEKIS
PRLSVIDQRDSVALVKLPYFGDEAHEGIIERAIPVMTVQTKEGPVQVTTVYDLILANYGI
DRGLGGEVATSYEEDTPYTPTWQEKITGVKADVVISTAREFADNAEQTKGRSMIIMGAGI
NHWYHADIIYRTILNLIMFCGTEGVNGGGWAHYVGQEKLRPVEGWAGIMTANDWSKAPRL
QNGTSWFYFAT

KEGG   T30302 (Metagenome): 20554
Entry
20554             CDS       T30302                                 

Definition
nitrate reductase, alpha subunit
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0222 (best score: 643.269)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.20554-T1-C
LinkDB
Position
C485221:complement(69..1088)
AA seq 339 aa
EKFIGLGPNIENKVGAHGLAWDVTDEYQSLYEQNGTIDQPGFVSHGRPSIYEAREACNVV
LTLSSCTNGKLAVRSWQAMEEKTGLTDLQKNAKGREEERITFDDMVRQPRFIIPSVTSTG
KNNKDRRYSPFTTSTEDKVPFRTVTGRQSFYCDHEMMRDYGEAMALYKPVLSYAPVKGDY
AQEGVPQITLKYLTPHHKWSTHSMYFDSQQLLTLFRGGQTIWLNEDDAKEINVQDNDWVE
AFNKNGIVAARAVVSPRIPRGISYMHHAQDRHINVPAAQIKKQRGGTHNAPTHIHLKPTH
MIGGYGQLSYGFNYYGPTGNQRDMTIVARKMKEVDWLED

KEGG   T30302 (Metagenome): 22531
Entry
22531             CDS       T30302                                 

Definition
nitrate reductase
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 169.859)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.22531-T1-C
LinkDB
Position
C487663:complement(1660..1917)
AA seq 85 aa
VVSHRMPEGVCYVHHAQERMMTPKTETTGKRGGIHNSMTRILLKPTHMIGGYAHQAFAFN
YLGPTGNQRDIVSYIRRRKSQEVTF

KEGG   T30302 (Metagenome): 7310
Entry
7310              CDS       T30302                                 

Definition
nitrate reductase
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 204.142)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.7310-T1-C
LinkDB
Position
C457721:1..303
AA seq 101 aa
DWMHEMGEALPIYRPPLDMTGLFKEPEIGTTDGVSVAVRYLTPHNKWAIHSQYFDNQHML
TLFRGGQTAWMSPQDAEKIGVKDGEWIECVNTNGVFVGRAV

KEGG   T30302 (Metagenome): 8578
Entry
8578              CDS       T30302                                 

Definition
nitrate reductase
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 199.519)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.8578-T1-C
LinkDB
Position
C460764:complement(3..323)
AA seq 107 aa
EGQEVTTVFDLMLATYGIGRPGLPGDWAKDYEDWSIQNTPAWQEQITSVPPEAVIRVARE
FAQNAIDSHGRSMIIFGAGICQWYHADTTYRAILALLNLTGCQGRNG

KEGG   T30302 (Metagenome): 8957
Entry
8957              CDS       T30302                                 

Definition
nitrate reductase
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04500 (best score: 179.874)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.8957-T1-C
LinkDB
Position
C461656:complement(3..263)
AA seq 87 aa
VYVKDGIITWEAQQTDYPTVGPDRPEYEPRGCPRGAAFSWYTYSPTRVKYPYVRGLLLEM
YREAKALHSDPVEAFHSIVSDPVKRNR

DBGET integrated database retrieval system