KEGG   T30302 (Metagenome): 15343
Entry
15343             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
hin:HI1125 (best score: 309.301)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15343-T1-C
LinkDB
Position
C475969:complement(49..534)
AA seq 161 aa
LLFSEAQARACAEAGVYLISPFVGRILDWYKANTDKKEYASAEDPGVISVTKIYNYYKEY
GYKTVVMGASFRNVGEIIELAGCDRLTIAPALLKELQENSTALVRKLEFKGEVKAKPQPL
TEAEFYWQHNSDAMAVEKLAEGIRKFAVDQEKLEAMLSAKL

KEGG   T30302 (Metagenome): 7814
Entry
7814              CDS       T30302                                 

Gene name
tal
Definition
transaldolase A
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
pmu:PM1602 (best score: 59.6918)
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7814-T1-C
LinkDB
Position
C458943:225..311
AA seq 29 aa
MTTQLDSLRNMTIVVADTGDIEAIKKYQP

KEGG   T30302 (Metagenome): 13466
Entry
13466             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
rmu:RMDY18_10940 (best score: 244.973)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13466-T1-C
LinkDB
Position
C472021:3..449
AA seq 149 aa
NVMIKIPATVEGLEPIAKTLAAGISVNVTLIFSLTRYREVINAYMLGLEEALKNGKDLSK
IHSVASFFVSRVDSEVDTRLNEIGTEEALALKGKAGLANARLAYEVFEEMFSSERWARLA
SHGANVQRPLWASTGVKDPALPDTLYVSG

KEGG   T30302 (Metagenome): 19677
Entry
19677             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
hin:HI1125 (best score: 564.303)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19677-T1-C
LinkDB
Position
C483853:complement(37..921)
AA seq 294 aa
IKKYQPQDATTNPSLILSASALPQYSPLIDEAVSYAKAQSNDKSQQLIDAEDKLAVNIGL
EILKIVPGRISTEVDARLSYDTQATVEKARKLIALYNAAGISNDRILIKIASTWQGIRAA
EILEKEGINCNLTLLFSEAQARACAEAGVYLISPFVGRILDWYKANSDKKEYAPAEDPGV
ISVTKIYNYYKEYGYNTVVMGASFRNVGEITELAGCDRLTIAPALLKELQENSTALVRKL
EYKGEVKAKPQPLTEAEFYWQHNSDAMAVEKLADGIRKFAMDQEKLETMLSAKL

KEGG   T30302 (Metagenome): 13964
Entry
13964             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
tmr:Tmar_0150 (best score: 53.1434)
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13964-T1-C
LinkDB
Position
C473059:complement(378..470)
AA seq 30 aa
PFNVLQQSLKHPLTDAGLARFLADWEAANK

KEGG   T30302 (Metagenome): 5524
Entry
5524              CDS       T30302                                 

Gene name
fsa
Definition
fructose-6-phosphate aldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
got:AXE85_07355 (best score: 338.191)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5524-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5114:complement(2016..2600)
AA seq 194 aa
GVTTNPSLIAKEGRDFKEVIKEIASIVDGPISGEVKATTTDWKDMVEEAREIAKIHSNMV
VKIPMTEDGLKAVNVLKKEGIKTNVTLIFSPTQALLAARAGATYVSPFLGRLDDIAHNGL
LLIEEIVEIFANNDIDTQIIAASVRNPIHVTECAKLGCDIATVPYNVIRQMVKHPLTDIG
IEKFKQDYYKVFGE

KEGG   T30302 (Metagenome): 18471
Entry
18471             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
rmu:RMDY18_10940 (best score: 120.938)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18471-T1-C
LinkDB
Position
C481835:558..764
AA seq 69 aa
MSDSTRKLSDAGVSIWLDDLSRDRLTSGSLAELISAKNVVGVTTNPTIFAGALSKGAAYA
EQMRQLAAS

KEGG   T30302 (Metagenome): 11321
Entry
11321             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
hin:HI1125 (best score: 238.039)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11321-T1-C
LinkDB
Position
C467166:3..383
AA seq 127 aa
SLILSASALPQYAPLIDEAVAYAKAQSADKAQQLIDAEDKLAVNIGLEILKIVPGRISTE
VDARLSYNTQATVEKARKLIALYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLT
LLFSEAQ

KEGG   T30302 (Metagenome): 19437
Entry
19437             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
hin:HI1125 (best score: 83.5741)
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19437-T1-C
LinkDB
Position
C483487:complement(3..131)
AA seq 43 aa
MTTQLDSLRKMTVVVADTGDIDAIKKYQPQDATTNPSLILSAS

KEGG   T30302 (Metagenome): 21826
Entry
21826             CDS       T30302                                 

Gene name
tal
Definition
transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Best hit
rmu:RMDY18_10940 (best score: 106.686)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21826-T1-C
LinkDB
Position
C486903:complement(1260..1493)
AA seq 77 aa
NTMPEATLNAVADHGEITGDTVTGEYTNSNKILDDIERLGISYVEVVDKLETEGLAKFDV
SWEELLETVRKALSESR

DBGET integrated database retrieval system