KEGG   T30302 (Metagenome): 15375
Entry
15375             CDS       T30302                                 

Gene name
pduL
Definition
ethanolamine utilization protein pduL
  KO
K15024  putative phosphotransacetylase [EC:2.3.1.8]
Best hit
cazo:G3A45_05055 (best score: 102.449)
Taxonomy
Firmicutes - Clostridia [GN:cazo]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.15375-T1-C
LinkDB
Position
C476037:2..259
AA seq 85 aa
KGKLTISQGVIVAHRHIHMHPDDAKRMGVIDKERVTVTVHGERELTFSNVIIRVSPKFAL
EMHIDVDEANAGRIKNNDIGIVSKS

KEGG   T30302 (Metagenome): 22222
Entry
22222             CDS       T30302                                 

Definition
hypothetical protein
  KO
K15024  putative phosphotransacetylase [EC:2.3.1.8]
Best hit
cso:CLS_23730 (best score: 106.301)
Taxonomy
Firmicutes - Clostridia [GN:cso]
Pathway
00430  Taurine and hypotaurine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.22222-T1-C
LinkDB
Position
C487337:1441..1695
AA seq 85 aa
MKQSEYLHLVTERVIAKLQELNRCSVPIGVSNRHVHVSKEAYTVLFGQDELTKKVDLKQP
GQYAANETVTLVGPKGSIEKVRILG

DBGET integrated database retrieval system