KEGG   T30302 (Metagenome): 15547
Entry
15547             CDS       T30302                                 

Definition
respiratory nitrate reductase, gamma subunit
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0225 (best score: 122.864)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.15547-T1-C
LinkDB
Position
C476409:369..548
AA seq 60 aa
MSLFLWGALPYIAFTFFVVGTLVRFFYFERNWTTKSSQFLEKKQLRIANPLFHFGLLCVI

KEGG   T30302 (Metagenome): 15831
Entry
15831             CDS       T30302                                 

Gene name
narI
Definition
respiratory nitrate reductase, gamma subunit
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04550 (best score: 123.635)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.15831-T1-C
LinkDB
Position
C476973:359..562
AA seq 68 aa
VPVGEPGIVDTLLWGVLPYVTILVLIGGTIWRYRTDQFSWTTRSSQIYESKMLRLGSPLF
HYGLAAVF

KEGG   T30302 (Metagenome): 19981
Entry
19981             CDS       T30302                                 

Gene name
narI
Definition
respiratory nitrate reductase, gamma subunit
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04550 (best score: 204.142)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.19981-T1-C
LinkDB
Position
C484325:2..334
AA seq 110 aa
PSGGLPPVNGHEVEFNYRTSIAVWFRSIFYFHPEVALMVNVPVAFKIHIIVAMVLFIIWP
FTRLVHALTVPLHYLFRPYTIYRSRGNERVGARRGWDNPQEALPRERVNR

DBGET integrated database retrieval system