KEGG   T30302 (Metagenome): 15694
Entry
15694             CDS       T30302                                 

Gene name
narH
Definition
nitrate reductase, beta subunit
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0223 (best score: 375.555)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.15694-T1-C
LinkDB
Position
C476719:complement(1..555)
AA seq 185 aa
GYPRHWEDQEKWKGGWTVGNDGKLALATGSKTNRLMKLFYHPEQPELKDYFEPWTYDYET
LIHSGRKNNQPVARPRSLVTKEKMEIKWGPNWDDDLAGGEHARSDVNLAKMGEDIVFDYE
KVFMRYLPRLCNHCLNPACVAACPSGAIYKRDEDGVVLVSQDVCRGWRHCVPSCPYKKIF
YNWET

KEGG   T30302 (Metagenome): 22530
Entry
22530             CDS       T30302                                 

Gene name
narH
Definition
nitrate reductase, beta subunit
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Best hit
rmu:RMDY18_04520 (best score: 1066.22)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.22530-T1-C
LinkDB
Position
C487663:complement(47..1660)
AA seq 537 aa
MRVMAQVAMVMALDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNVETRPGQGYPRRYEDQE
KWKGGWVLNKRGRLELKSGNRFQKLFSIFASPIQPELTDYYEPWTYDYQNLTTAPLGDDF
PAAKPVSMITGQDTKIQWGLNWDDNLGGAPEHGHLDPLVEKVRKKAEDKIKFEFEQTFMF
YLPRICEHCLNPSCMAACPSGAIYKRAEDGIVLVDQDRCRGWRQCITGCPYKKVYFNHKT
GKAEKCTFCYPRIEAGIPTVCAETCVGRMRYIGIFLYDADRVTEAASVADEKDLYESQLS
LMLDPSDPEIIRLARENDIPEAWITAAQKSPVYKLAKEWKVALPLHPEYRTMPMVWYVPP
LSPIVDLLKDQGHDAENSQNLFGAIEALRIPVEYLAELFTAGDTEVVTFVLKRLAAMRAY
MRDINLGGEGNEEIANSVGMTGAQMYEMYRLMAIAKYNERYVIPPAHMEDAHNLEEMGCS
LSVDGGPGMYGDAFNDMEGRPTPVSTGVYESSNKVSLFSWDGNSRPDGLFPNTTGKK

KEGG   T30302 (Metagenome): 9004
Entry
9004              CDS       T30302                                 

Gene name
narH
Definition
nitrate reductase, beta subunit
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Best hit
vpr:Vpar_0223 (best score: 194.897)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02020  Two-component system
Other DBs
HMP: SRS016196.9004-T1-C
LinkDB
Position
C461770:1..333
AA seq 111 aa
DTDIYENTVDLILDPHDPEVVKAARAEGIGEAWIKAAQKSPVYKLIKEWKVGLPLHPEYR
TLPMVWYVPPLSPIVQRITSEVYLPDANEMRVPVQYLANLFTAGNADALAR

DBGET integrated database retrieval system