KEGG   T30302 (Metagenome): 16049
Entry
16049             CDS       T30302                                 

Gene name
ctaD
Definition
cytochrome-c oxidase
  KO
K02274  cytochrome c oxidase subunit I [EC:7.1.1.9]
Best hit
rdn:HMPREF0733_11925 (best score: 424.476)
Taxonomy
Actinobacteria [GN:rdn]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16049-T1-C
LinkDB
Position
C477365:2..574
AA seq 191 aa
VKFFNWIGTMWQGSITFETPLLWIYGFLVTFLFGGLTGIILATPPLDFHISDTYFVVAHF
HYVIFGTIVFGMFGAFYFWWPKFTGKMLNERIGKIHFWLVFFGFHATFLIQHWVGVDGMP
RRYADYLPEDGFTWMNQFSTVGSMILAVSMIPWFWNVYITARYAPKVEVDDPWGFGGSLE
WATSCPPPRHN

KEGG   T30302 (Metagenome): 19190
Entry
19190             CDS       T30302                                 

Gene name
ctaD
Definition
cytochrome-c oxidase
  KO
K02274  cytochrome c oxidase subunit I [EC:7.1.1.9]
Best hit
rdn:HMPREF0733_11925 (best score: 580.867)
Taxonomy
Actinobacteria [GN:rdn]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19190-T1-C
LinkDB
Position
C483073:3..857
AA seq 285 aa
MALLMRIELFEPGMQILQTKEQFNQLFTMHGTLMLLMFGTPLFTGLANVLIPLQIGAPDV
AFPRLNALAFWFFLFGSLVAIAGFITPQGAASFGWFAYVPLNSTTYSPSVGGDLWVFGLA
LQGFGTIMGAVNFITTIVAMRAPGMTMWRMSVFTWATLITSILIIMIFPPLASALFALGM
DRRFGGHIFDPENGGAVLWQHLFWFFGHPEVYVLALPFFGVTSEIIPVFSRKPIFGYKGL
VTATIAIAGLSVTVWAHHMYVTGAIMLPFFSFMTMMIGVPTGVKF

DBGET integrated database retrieval system