KEGG   T30302 (Metagenome): 16243
Entry
16243             CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
vpr:Vpar_0845 (best score: 331.643)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16243-T1-C
LinkDB
Position
C477741:complement(3..584)
AA seq 194 aa
TGQVHVVGEITTNTYVDIPHIVRDTIREIGYTRAKFGFDADTCGVNVAIDEQSADIAMGV
DEALESREGGSDAFDKIGAGDQGMMFGFASNETEELMPMPISLAHRLSRQLTKVRKDNTL
DYLRPDGKTQVTVEYVDGKPKRIETIVISTQHGPEVTLEQIQADIKKYVIDPVLPEGFID
ENTKYFINPTGRFV

KEGG   T30302 (Metagenome): 3310
Entry
3310              CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
spy:SPy_1359 (best score: 201.83)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3310-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3322:3..338
AA seq 112 aa
GGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVR
IDTFGTGTVAESKLEKAARQIFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRT

KEGG   T30302 (Metagenome): 15750
Entry
15750             CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
paet:NCTC13378_01377 (best score: 177.948)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15750-T1-C
LinkDB
Position
C476821:3..275
AA seq 90 aa
CEIQLSYAIGVAEPTSIMVETFGTGKVSNEVLVKLVREFFDLRPYGLIKMLNLIQPIYRQ
TAAYGHFGREQFPWEKVDRAEELRAAAGLK

KEGG   T30302 (Metagenome): 3503
Entry
3503              CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
got:AXE85_07215 (best score: 283.493)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3503-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3501:complement(3..476)
AA seq 158 aa
PDKIADQVSDAILDAILEQDPYGRVACETCVNTGLAVLVGEVSTTANVDFQQIVRDTINE
IGYTDPNKGYSGDHISVLVGLDKQSPDIALGVDNSLETKQQKEENEVGAGDQGLMFGFAT
NETPTFMPLPIYLSQKLSKQLAEVRKNGTLSYLGPDGK

KEGG   T30302 (Metagenome): 12344
Entry
12344             CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
vpr:Vpar_0845 (best score: 209.92)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12344-T1-C
LinkDB
Position
C469557:3..353
AA seq 116 aa
KVDRSAAYAARYVAKNIVAAGLADKCEVQVAYAIGVAKPVSIMVETFGTAKIEEEKISAL
VSKHFDLRPAGIIEMLDLLKPHYKKTAAYGHFGRTDVDLPWERTDKAEVLRKEAGL

KEGG   T30302 (Metagenome): 22698
Entry
22698             CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
hin:HI1172 (best score: 304.679)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.22698-T1-C
LinkDB
Position
C487849:complement(2..454)
AA seq 151 aa
MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS
AWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQ
GIMFGYATNETDVLMPAAITYAHRLMEKQAE

KEGG   T30302 (Metagenome): 17425
Entry
17425             CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthetase, N-terminal domain
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
rmu:RMDY18_11270 (best score: 304.679)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17425-T1-C
LinkDB
Position
C480031:complement(1..471)
AA seq 157 aa
VSNNHLRLFTSESVTEGHPDKICDQISDAILDGIIAQDSTANVAVETMVTTGQVHVAGEV
TTSSYVEIPSIVRETILGIGYDSSTRGFDGEFCGVSVSIGEQSPDINAGVYESLEARSGI
AVDDYDRQGAGDQGIMFGYASNETNVLMPAPIWLAHR

KEGG   T30302 (Metagenome): 22291
Entry
22291             CDS       T30302                                 

Gene name
metK
Definition
methionine adenosyltransferase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
hin:HI1172 (best score: 422.165)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.22291-T1-C
LinkDB
Position
C487405:1082..1741
AA seq 220 aa
MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS
AWVDIENLTRQVICDIGYKHSDMGFDGNSCAVLNAIGKQSSDINQGVDRENPLDQGAGDQ
GIMFGYATNETEVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVG
VDAVVLSTQHSEEVSQKEIYEGVMEEIIKPILPSEWLSQQ

KEGG   T30302 (Metagenome): 6207
Entry
6207              CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
got:AXE85_07215 (best score: 101.679)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6207-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5555:1..168
AA seq 55 aa
IKEEFRLTPNGIIETLDLRKPIFKKTAAYGHFGREDVEFTWERTDKVEAFKKLLK

KEGG   T30302 (Metagenome): 541
Entry
541               CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
pmu:PM1027 (best score: 196.823)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.541-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_632:3..380
AA seq 125 aa
IGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKXXXXXXXXXIGVADPTSIMVETFGTG
KVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFPWEKVDRAAELRV
AAGLK

KEGG   T30302 (Metagenome): 1087
Entry
1087              CDS       T30302                                 

Gene name
metK
Definition
S-adenosylmethionine synthetase, central domain
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Best hit
spy:SPy_1359 (best score: 159.073)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1087-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1177:3..344
AA seq 114 aa
ADLRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEVSNEQIHNDVINKVI
KEVIPASYLDEQTKXXXXXXGAFSGKDATKVDRSASYAARYIAKNIVAXXXXXX

DBGET integrated database retrieval system