KEGG   T30302 (Metagenome): 16350
Entry
16350             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Best hit
amar:AMRN_0878 (best score: 48.521)
Pathway
00520  Amino sugar and nucleotide sugar metabolism
00541  O-Antigen nucleotide sugar biosynthesis
01100  Metabolic pathways
02020  Two-component system
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.16350-T1-C
LinkDB
Position
C477959:2..94
AA seq 30 aa
EYSKMSKASNPYGDGKACERIVDIILEGLS

KEGG   T30302 (Metagenome): 18494
Entry
18494             CDS       T30302                                 

Gene name
mnaA
Definition
UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Best hit
gsa:FOC50_04695 (best score: 348.206)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00520  Amino sugar and nucleotide sugar metabolism
00541  O-Antigen nucleotide sugar biosynthesis
01100  Metabolic pathways
02020  Two-component system
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.18494-T1-C
LinkDB
Position
C481873:complement(3..674)
AA seq 224 aa
MKKVMLVFGTRPEAIKMCPLVNELKKNDSIKTLVCVTGQHKEMLEQVLDVFKVVPDYDLG
IMKANQTLFTITTSILDKIQAVLEQEKPDIVLVHGDTTTTFATALAAFYMGIKVGHVEAG
LRTYNLQSPFPEEFNRQTTSIISDFNFAPTEVAKENLLKEGRENIYVTGNTVIDALKTTV
QEHYDHPILEWAKDSKLIMLTAHRRENLGQPMENMFNAVNRILN

KEGG   T30302 (Metagenome): 13886
Entry
13886             CDS       T30302                                 

Definition
UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Best hit
vpr:Vpar_1541 (best score: 204.142)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00520  Amino sugar and nucleotide sugar metabolism
00541  O-Antigen nucleotide sugar biosynthesis
01100  Metabolic pathways
02020  Two-component system
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.13886-T1-C
LinkDB
Position
C472911:119..466
AA seq 116 aa
MLKVMTIFGTRPEAIKMAPVVKALEAAPDMESIVTVTAQHREMLDQVLHLFSITPNYDLN
IMSQGQTLYDVTCRALMGLQEVLKEAKPDVVLVHGDTTTTFVGALAAFYEGIPVGH

KEGG   T30302 (Metagenome): 17911
Entry
17911             CDS       T30302                                 

Definition
UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Best hit
vpr:Vpar_1541 (best score: 268.855)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00520  Amino sugar and nucleotide sugar metabolism
00541  O-Antigen nucleotide sugar biosynthesis
01100  Metabolic pathways
02020  Two-component system
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.17911-T1-C
LinkDB
Position
C480889:1..570
AA seq 189 aa
LNKIDYVNQKVILVTTHRRENLGNPMRNVYEAIRDIIGEHEEVEVIFPMHRNPKVRSIVQ
EVLGDMPRVHLIEPLEYEPFANLMDRTYLIMTDSGGIQEEAPSLGKPVLVLRDTTERPEA
VQAGTVKLVGTDKATVYFTAKELITNAEMYTAMSNAVNPYGDGLASERIVQALRHEFFEN
QEKPSSFGK

KEGG   T30302 (Metagenome): 18327
Entry
18327             CDS       T30302                                 

Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
spy:SPy_1944 (best score: 208.764)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.18327-T1-C
LinkDB
Position
C481601:427..753
AA seq 109 aa
MGWWKETIDIVKENDPAARNSLEVLLTYPGIKALAAHRLSHFLWKHGFKLLARMHSQFWR
FWTQIEIHPGAQIESGVFIDHGSGLVIGETAVVEKGAMLYHGVTLGGTG

KEGG   T30302 (Metagenome): 14687
Entry
14687             CDS       T30302                                 

Definition
serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
got:AXE85_08015 (best score: 130.568)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.14687-T1-C
LinkDB
Position
C474589:283..501
AA seq 73 aa
MGYFENLNYNLNRVLKDDPAAESKLMIYLTYPHIKALNYHFFAHKLYKKGWHTTARLVSK
RARRKTGIEIHPG

KEGG   T30302 (Metagenome): 11922
Entry
11922             CDS       T30302                                 

Definition
putative serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
vpr:Vpar_0142 (best score: 135.191)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.11922-T1-C
LinkDB
Position
C468579:2..346
AA seq 114 aa
AIVGDNVTLFHGVTLGGMDSRKIKRHPTVEDDVLIGAGTKVLGDITVGKGSKIGCNLVIK
RDVPKNVIIFETEPEHIIYRRPKVDRFDKGSYVPRRHALPLEPNDFTDHMAWHI

KEGG   T30302 (Metagenome): 1706
Entry
1706              CDS       T30302                                 

Gene name
cysE
Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
got:AXE85_08015 (best score: 297.745)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.1706-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1776:704..1234
AA seq 176 aa
MGYFENLNYNLNRVLRDDPAAESKLMVYLTYPHIKALNYHYFSHKFYKKGWHTFARLLSK
RARRLTGIEIHPGAKIGKGLFIDHGMGVVIGETAVVGDNVTMYHGTTLGGTTLDPIKRHP
TIGDNVMIGAGAKVLGNITIGKNSKIGANAVVKHSVPDGTIVYEARPVVRYFEEDK

KEGG   T30302 (Metagenome): 19192
Entry
19192             CDS       T30302                                 

Gene name
cysE
Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
hin:HI_0606 (best score: 433.335)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.19192-T1-C
LinkDB
Position
C483075:129..857
AA seq 243 aa
MARLANKMGGERGYNMTLEVWQYIRQEAKMLAEHEPMLASFFHSTILKHQNLGSALSYLL
ANKLANPIMPAISLREIIEEAYQANPSIIDCAASDIKAVRQRDPAVELWTTPLLYLKGFH
AIQSYRITHYLWNQNRKALALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSI
IENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLHP
VPE

KEGG   T30302 (Metagenome): 2556
Entry
2556              CDS       T30302                                 

Gene name
cysE
Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
rpne:NCTC8284_00131 (best score: 346.665)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.2556-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2601:1..528
AA seq 176 aa
DPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKALALYLQNQISVAFDVDIHPAAKIG
HGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGN
IEVGKYAKIGANSVVLQPVPEYATAAGVPARIVGKDKAAKPAFEMNQYFIDDDINL

KEGG   T30302 (Metagenome): 18939
Entry
18939             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
hin:HI_0606 (best score: 46.2098)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.18939-T1-C
LinkDB
Position
C482653:complement(3..71)
AA seq 23 aa
MTLEVWQHIRQEAKELAECEPML

KEGG   T30302 (Metagenome): 14067
Entry
14067             CDS       T30302                                 

Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
rmu:RMDY18_07930 (best score: 120.553)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.14067-T1-C
LinkDB
Position
C473271:complement(288..476)
AA seq 62 aa
AKVLGPVVIGADSAIGANAVVVNDHPRDSIITGIPAKHRLRTPEKKKPLVDAVEYIDPAM
WI

KEGG   T30302 (Metagenome): 6090
Entry
6090              CDS       T30302                                 

Definition
hypothetical protein
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Best hit
scg:SCI_0833 (best score: 354.755)
Taxonomy
Firmicutes - Bacilli [GN:scg]
Pathway
00360  Phenylalanine metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.6090-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5483:complement(1..684)
AA seq 228 aa
DYPIISKKDISHNLDSFINQKYNKENLILKKTSGSTGIPLEVYKSSNDLLTQLKVLWKFR
SREFKIEPCAKYLVFNLSRYSFDSIDQRYKHINNTLAINITCISVKEFEELSKVIFHFQP
EFIMGTPTSVCDLIYVYKKYNKHTPKSIRYVELMSEPLFPFQRHMILQAFNCPISNHYGC
TEVMGIAQQKNGSNELSIFEENVVLENIEEKIIITGINSIAMPFIRYD

KEGG   T30302 (Metagenome): 13431
Entry
13431             CDS       T30302                                 

Definition
glycosyltransferase, wecB/tagA/cpsF family
  KO
K05946  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [EC:2.4.1.187]
Best hit
vpr:Vpar_1053 (best score: 83.5741)
Pathway
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.13431-T1-C
LinkDB
Position
C471947:complement(293..448)
AA seq 51 aa
FDVLAGMLKRAPVWMQENRLEWLYRLALQPKRIIRMLALPKFMWTVWRHKH

DBGET integrated database retrieval system