KEGG   T30302 (Metagenome): 16421
Entry
16421             CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
vpr:Vpar_1532 (best score: 176.792)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.16421-T1-C
LinkDB
Position
C478095:2..307
AA seq 101 aa
LQKYKDLQDIIAILGMEELSEADKLTVARARKIQRFLSQPFFVAEVFTGSPGKYVPLKET
LRGFREILEGKHDDLPESAFYMVGTIDEAVAKGRDMLGKGE

KEGG   T30302 (Metagenome): 4710
Entry
4710              CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase F1, beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
got:AXE85_07440 (best score: 492.656)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.4710-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4460:complement(3..755)
AA seq 251 aa
VLIQELINNVAQQHGGLSVFTGVGERTREGNDLYYEMKDSGVINKTAMVFGQMNEPPGAR
MRVALTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEM
GRLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERALTEMGIYPAVD
PLASTSRALAPEIVGEEHYQVATRIQRTLQKYRELQDIIAILGMDELSDEDKKTVDRARR
VQFFLSQNFHV

KEGG   T30302 (Metagenome): 2523
Entry
2523              CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
spy:SPy_0760 (best score: 286.574)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2523-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2564:1..474
AA seq 158 aa
ELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTED
AERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELI
HNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEK

KEGG   T30302 (Metagenome): 8868
Entry
8868              CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
rpne:NCTC8284_00250 (best score: 214.927)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.8868-T1-C
LinkDB
Position
C461438:3..329
AA seq 109 aa
PQDAVPKVYDALKVESGLTLEVQQQLGGGVVRCIALGTSDGLKRGLKVENTGNPIQVPVG
TKTLGRIMNVLGEPIDEQGEIGAEENWAIHRPAPSYEEQSNSTELLETG

KEGG   T30302 (Metagenome): 14039
Entry
14039             CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
rpne:NCTC8284_00250 aap:NT05HA_2000 hin:HI_0479 paet:NCTC13378_01923
(best score: 306.99)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14039-T1-C
LinkDB
Position
C473221:3..473
AA seq 157 aa
NRLRVALTGLTMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEE
MGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAV
DPLDSTSRQLDPLVVGQEHYDVARGVQGILQRYKELK

KEGG   T30302 (Metagenome): 7681
Entry
7681              CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
vpr:Vpar_1532 (best score: 148.673)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.7681-T1-C
LinkDB
Position
C458609:complement(2..307)
AA seq 102 aa
GKVVQVIGPVVDVVFPKGELPAIYNAITITKGDEQASKIVVEVMQHLGDDTVRCVAMSST
DGLTRGMEAVDTGAAISVPVGDGVLGRIFNVLGETVDHDPAE

KEGG   T30302 (Metagenome): 5058
Entry
5058              CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
rmu:RMDY18_12830 (best score: 458.759)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.5058-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4759:complement(443..1159)
AA seq 238 aa
FRDVKNQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPNLADEMGLLQERITSTRGH
SITSMQAIYVPADDYTDPAPATTFAHLDATTELSREIASRGLYPAIDPLTSTSRILDPQY
IGQEHYDTAIRVKAILQENKDLQDIIAILGVDELSEEQKVVVSRARRIEQFLSQNTYTAK
QFTGVEGSTVPLKDTIESFQMICNGDVDHIPEQAFYNIGGMDDVMRQYEEIKAQTGAK

KEGG   T30302 (Metagenome): 20101
Entry
20101             CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
rmu:RMDY18_12830 (best score: 302.753)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.20101-T1-C
LinkDB
Position
C484513:complement(1..510)
AA seq 170 aa
MTTTTTQGATGRIARVIGPVVDVEFPAGQVPDIYNALTTELTLDGKTYTITFETAQHLGD
SIVRAISMQQTDGLVRGQAVLDTGAPIAVPVGDGVKGHLFNVLGNALDVPNSDIDADAYW
PIHRAAPGFAELEGSTEMLETGIKSIDLLTPYIKGGKIGLFGGAGVGKTV

KEGG   T30302 (Metagenome): 14031
Entry
14031             CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
hin:HI_0479 paet:NCTC13378_01923 rpne:NCTC8284_00250 aap:NT05HA_2000
(best score: 306.605)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14031-T1-C
LinkDB
Position
C473203:3..473
AA seq 157 aa
NRLRVALTGLTMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEE
MGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAV
DPLDSTSRQLDPLVVGQEHYDIARGVQGILQRYKELK

KEGG   T30302 (Metagenome): 14048
Entry
14048             CDS       T30302                                 

Gene name
atpD
Definition
ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Best hit
vpr:Vpar_1532 (best score: 283.493)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14048-T1-C
LinkDB
Position
C473239:complement(2..475)
AA seq 158 aa
VDHDPAEVKVNEHWPIHRAAPKFDELAPETNILETGIKVVDLIAPYVKGGKIGLFGGAGV
GKTVLIMELIHNIATEHGGYSVFAGVGERTREGNDLWNEMKESGVLSKTALVYGQMNEPP
GARMRVALTGLTMAEYFRDVQQQDVLLFVDNIFRFIQA

DBGET integrated database retrieval system