KEGG   T30302 (Metagenome): 17495
Entry
17495             CDS       T30302                                 

Definition
acetyl-coA carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 129.028)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.17495-T1-C
LinkDB
Position
C480165:complement(3..233)
AA seq 77 aa
VTHNPAKAIKNFTAVPGHHTGPVSKILIANRGEIAVRIIRAARDEGLETVAVYAEPDRDA
QHVKLADEAYALGGATA

KEGG   T30302 (Metagenome): 9584
Entry
9584              CDS       T30302                                 

Definition
acetyl-coA carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 208.764)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016196.9584-T1-C
LinkDB
Position
C463164:2..343
AA seq 114 aa
RFLDSPRHIETQCLADAHGNVQVVSTRDCSLQRRNQKLVEEAPAPYLTEEQSDRLYEASR
KILQEAGYQGAGTCEFLLAPDGAISFLEVNTRLQVEHPVSEEVSGIDLVREQFR

DBGET integrated database retrieval system