KEGG   T30302 (Metagenome): 17912
Entry
17912             CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_00148 (best score: 415.231)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17912-T1-C
LinkDB
Position
C480891:1..714
AA seq 238 aa
VSSPLIGTDAFQEADVLGLSLACTKHSFIVQSANELADVFAEAFEIAQSGRPGPVLIDVP
RDIQIGEVPANVKAYVKTPEKPTALSVDKLEEAKELLKNAKKPVLYVGGGVGMAKAVPAL
REFLSQTKMPSVSTLKGLGAIHPNDDVYMGMIGMHGTKAANFAVQESDLLLVCGARFDDR
VTGKLDTFAPHAKVVHCDIDVAEIHKLRRADVALQGDLIQALNALKQDLDIEPWREQI

KEGG   T30302 (Metagenome): 18623
Entry
18623             CDS       T30302                                 

Gene name
ilvB
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
lgo:JCM16774_0697 (best score: 343.199)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18623-T1-C
LinkDB
Position
C482117:70..783
AA seq 238 aa
MDEMDIERGQTMSEQKMIRGARILLETLKRLGVTDIFGYPGGAVIPIYNEIYDFEGINHY
LARHEQGAAHEADGYARASGKCGVCLATSGPGATNLVTGIMTAHMDSIPLLAITGQVASH
LLGKDAFQESDIIGITMPVTKNNYLVQDIRDIARTVKEAYYLATTGRPGPVLVDITRDAQ
LAEISYEEFEAIFNEPISLEGYDPNYIGHKKQIKKAIEIVKAAKRPLIIAGHGVLLSG

KEGG   T30302 (Metagenome): 17985
Entry
17985             CDS       T30302                                 

Gene name
ilvI
Definition
acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI1585 (best score: 258.07)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17985-T1-C
LinkDB
Position
C481015:complement(2..400)
AA seq 133 aa
MKKLSGAEMVVQSLRDEGVEYLFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADG
YARATGKVGCVLVTSGPGATNAITGILTAYTDSVPMVIISGQVMSSLIGRDAFQECDMVG
ISRPVVKHSFIVK

KEGG   T30302 (Metagenome): 17297
Entry
17297             CDS       T30302                                 

Definition
acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
lba:Lebu_1757 (best score: 174.866)
Taxonomy
Fusobacteria [GN:lba]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17297-T1-C
LinkDB
Position
C479799:1..396
AA seq 131 aa
VLITGDGGLQMNSQELLLLKAYNIPVKVVIINNGFLGMVRQWQELFNNHRYSFVDLSISP
DFEVLAQAYGVRGVTLSTIEDLRSQLRDLILSDEPVVINCIVEKEENVFPMIPAGCSAKD
MIGLKGGPDNE

KEGG   T30302 (Metagenome): 2031
Entry
2031              CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hap:HAPS_0144 (best score: 305.834)
Taxonomy
Gammaproteobacteria - Others [GN:hap]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2031-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2069:complement(3..578)
AA seq 192 aa
ALQGDLIQALEALSIPLAIDDWRAHIQALKAKLDFTYIDNAGNRPIDPWSLLNTLSQRKP
QNAVICTDVGQHQMWSAQHMRHFAPENYITSAGFGTMGFGLPAAVGAKKARPHDEVILVT
GDGSLMMNIQELGSIKRGKLPVKILLLDNQRLGMVRQWQDLFWNKRRSETILEDNPDFVM
LAKAFDIPAERI

KEGG   T30302 (Metagenome): 9505
Entry
9505              CDS       T30302                                 

Gene name
ilvB
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rmu:RMDY18_07490 (best score: 199.904)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9505-T1-C
LinkDB
Position
C462976:complement(1..342)
AA seq 114 aa
NNIPIKVAVVNNSSLGMVRQWQALFYDGRYSNTHLRTGHGTDRIPDFVKLGDAYGCATFR
CERDEDVDEVIKQALAINDRPVVIDFTVSPDAMVWPMVPAGVSNDLIQIAKNTS

KEGG   T30302 (Metagenome): 8213
Entry
8213              CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hso:HS_0147 (best score: 194.126)
Taxonomy
Gammaproteobacteria - Others [GN:hso]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8213-T1-C
LinkDB
Position
C459892:complement(3..317)
AA seq 105 aa
NAVICTDVGQHQMWSAQHMKHFAPENYITSAGFGTMGFGLPAAVGAKKARPQDEVILVTG
DGSLMMNIQELGSIKRGNLPVKILLLDNQRLGMVRQWQDLFWNKR

KEGG   T30302 (Metagenome): 16797
Entry
16797             CDS       T30302                                 

Gene name
ilvI
Definition
acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI1585 (best score: 406.371)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16797-T1-C
LinkDB
Position
C478813:complement(1..621)
AA seq 207 aa
LAHRLNLPVTASLMGLGAYPSTDKQFLGMLGMHGTFEANTAMHESDLILGVGVRFDDRTT
NNLEKYCPNAKVIHIDIDPTSISKNVPAAIPIVGNAKNVLEEFLSLLNEEGLKSQTDLES
WWQEINQWKAKKCLEFDRASGVIKPQQVMEAVYRLTKGQAYVASDVGQHQMFTALHYPFD
EPRHWINSGGAGTMGFGLPAALGVKLA

KEGG   T30302 (Metagenome): 14221
Entry
14221             CDS       T30302                                 

Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rmu:RMDY18_07490 (best score: 275.404)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14221-T1-C
LinkDB
Position
C473615:2..481
AA seq 160 aa
LAKLAEITGAPVVTTLNARGAFPDSNPQNLGMPGMHGTVPAVFAMQKSDLLITLGARFDD
RVTGKLDSFAPEAKVIHIDVDPAEISKIRFADVPIVGDLRYVLPELNELLSTEFANKLPN
LGEWWVELDTIKNDYPLGYTKTDDGLGSPQHVLERLSALT

KEGG   T30302 (Metagenome): 21201
Entry
21201             CDS       T30302                                 

Gene name
ilvB
Definition
acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI1585 (best score: 747.273)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21201-T1-C
LinkDB
Position
C486101:3..1253
AA seq 417 aa
PVVVDIPKDTVNPTLKYPYEYPKSVELRSYNPTVNGHKGQIKKALKALLVAKKPVLFVGG
GAIAAGCHEELTQFAQRLNLPVTSSLMGLGVYPSTDKQFLGMLGMHGTYEANTAMHESDL
ILGVGVRFDDRTTNNLDKYCPNAKVIQIDIDPTSISKNVPAAIPIVGNAKNVLDEFLSLL
GEEIGSRPQNHLEDWWKQIDEWKAKKCLDFDRTSGVIKPQQVMEAVYRITKGQAYVASDV
GQHQMFAALHYPFDLPRRWINSGGAGTMGFGLPAALGVKLAHPDATVVCVTGDGSIQMNI
QELSTATQYGIPVVVICLNNHFLGMVKQWQDLIYSGRHSQTYMNSLPDFVKLAESYGHVG
IQISTPDELESKLQEAFSIKNKLVFVDINVDETEHVYPMQIRGGAMNEMILSKTERT

KEGG   T30302 (Metagenome): 18720
Entry
18720             CDS       T30302                                 

Gene name
ilvI
Definition
acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI1585 (best score: 259.225)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18720-T1-C
LinkDB
Position
C482291:complement(2..400)
AA seq 133 aa
MKKLSGAEMVVQSLRDEGVEYLFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADG
YARSTGKVGCVLVTSGPGATNAITGILTAYTDSVPMVIISGQVMSSLIGRDAFQECDMVG
ISRPVVKHSFIVK

KEGG   T30302 (Metagenome): 569
Entry
569               CDS       T30302                                 

Gene name
ilvB
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
lgo:JCM16774_0697 (best score: 172.94)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.569-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_660:2..373
AA seq 124 aa
EIEKNKLIDVPIVGDLKHVLNEMNHELTPQTHEDWLERIREWREEYPIRVRPHEGESLLP
QKVIQEIDNIVKGNAIVVTDVGQHQMWASQFITYSKPNTIITSGGAGTMGFGLPAAIGAQ
VAQP

KEGG   T30302 (Metagenome): 13382
Entry
13382             CDS       T30302                                 

Gene name
alsS
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
lmo:lmo2006 (best score: 222.631)
Taxonomy
Firmicutes - Bacilli [GN:lmo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13382-T1-C
LinkDB
Position
C471845:2..445
AA seq 148 aa
DIGSHGIWLARHFRSYEPRHLLFSNGMQTLGVALPWAIASGLLYPNKKTLSISGDGGFLF
SAMELETAVRLKSPIVHVVWNDSSYNMVAFQQEMKYGRDSAVHLGQVDIKKHAESYGAVG
MRATTKEEFAKCLEEAFKIEGPVVIDVP

KEGG   T30302 (Metagenome): 21392
Entry
21392             CDS       T30302                                 

Definition
acetolactate synthase isozyme II large subunit (AHAS-II)
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_00147 (best score: 147.132)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21392-T1-C
LinkDB
Position
C486371:1..246
AA seq 81 aa
FWNKRRSETILDDNPDFVMLANAFGIPAERIESADDVDAALNRLLNSKTAYLLQVCIPPD
ECVWPLVPPGACNADMVEEMN

KEGG   T30302 (Metagenome): 19915
Entry
19915             CDS       T30302                                 

Gene name
ilvI
Definition
acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI1585 (best score: 278.1)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19915-T1-C
LinkDB
Position
C484229:1..417
AA seq 138 aa
HPEATVVCVTGDGSIQMNIQELSTATQYGIPVVIICLNNHFLGMVKQWQDLIYSGRHSQT
YMNSLPDFVKLAESYGHVGIKIATPDELESKLQEAFSIKNKLVFVDINVDESEHVYPMQI
RGGAMNEMILSKPQEETN

KEGG   T30302 (Metagenome): 18087
Entry
18087             CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_00148 (best score: 313.923)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18087-T1-C
LinkDB
Position
C481187:complement(3..566)
AA seq 188 aa
MTGAQLIIECLKAHGVTDLFGYPGGAIMPTYDAIYDSGLDHLLCRNEQGAAIAAIGYARS
TGKVGVCVATSGPGATNLITGLGDAFADSVPIVAFTGQVAAPLIGTDAFQEADVLGLSLA
CTKHSYIVQSVEELPEIIASAFQIAQSGRPGPVLIDVPRNIQVGDVPEHIKPIVKPTVKP
TALSELKL

KEGG   T30302 (Metagenome): 5863
Entry
5863              CDS       T30302                                 

Gene name
alsS
Definition
acetolactate synthase, catabolic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
lmo:lmo2006 (best score: 518.464)
Taxonomy
Firmicutes - Bacilli [GN:lmo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5863-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5338:complement(393..1685)
AA seq 430 aa
PVTKSAVEVGHQDSISEAITNAFRKAKEPKKGATFVSLPADVINENTSVKAIKRLKEPVL
GIADPKHVSDLVEKIENSQLPVLLLGMNASTKEATEAIRLLVAKTGIPVVEMFQAAGVIS
RGLVQHFYGRVGLFRNQPGDRLLNKADLIISIGYDPIEYDPVYWNTNKNATLVHIDDTIA
VIDRDYQPDIELIGDISATLKCIYEGNPKVRISEENLSYLKELQEEIVKRDEPPKSKIEG
RLHPLEIIQQTQNAVSDDTIVTCDIGSHGIWLARHFRSYEPRHLLFSNGMQTLGVALPWA
IASGLLYPNKKTLSISGDGGFLFSAMELETAVRLKSPIVHVVWNDSSYNMVAFQQEMKYG
RDSAVHLGQVDIKKHAESYGAVGMRATTKEEFAKCLREAFQIEGPVVIDVPVDYSDNIKL
GETLQDSYLN

KEGG   T30302 (Metagenome): 10097
Entry
10097             CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_00148 (best score: 179.489)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10097-T1-C
LinkDB
Position
C464378:3..353
AA seq 117 aa
ALSELKLAEAKALLTQAKKPVLYVGGGVGMANAIQAVRKFLQITKMPSVSTLKGLGSIDP
IDPVYMGMIGMHGTRPANIAVHECDLLLVCGARFDDRVTGKLDSFAPQAKVIHCDID

KEGG   T30302 (Metagenome): 1378
Entry
1378              CDS       T30302                                 

Definition
acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_00147 (best score: 103.99)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1378-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1473:complement(551..721)
AA seq 56 aa
DIPAERIERADDVDAALNRLLNSETAYLLQVCIPPEECVWPLVPPGACNTDMLEEI

KEGG   T30302 (Metagenome): 21011
Entry
21011             CDS       T30302                                 

Definition
putative uncharacterized protein HI_0737
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
hin:HI0737 hix:NTHI723_00925 rpne:NCTC8284_00148 (best score:
97.0561)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21011-T1-C
LinkDB
Position
C485845:1062..1196
AA seq 45 aa
MTGAQLIMECLKAHHVTTLFGYPGGAIMPTYDALYDAGLDHLLCR

KEGG   T30302 (Metagenome): 6063
Entry
6063              CDS       T30302                                 

Gene name
alsS
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
bsu:BSU36010 (best score: 197.593)
Taxonomy
Firmicutes - Bacilli [GN:bsu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6063-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5468:936..1340
AA seq 135 aa
MRDNLDKSSRRGAELVVDTLINEGVKHVFAIPGAKIDAVFDALVDRGPELIVVRHEQNAA
FMAQAVGRLTGKPGVALVTSGPGVSNLATGLITANSEGDPVVAIGGQVKRSDLLKQTHQS
MDNVSLLRPVTKSAV

KEGG   T30302 (Metagenome): 3156
Entry
3156              CDS       T30302                                 

Gene name
ilvB
Definition
acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Best hit
spn:SP_0445 (best score: 340.887)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3156-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3178:190..705
AA seq 172 aa
MEKISLESPKTGSDLVLETLRDLGIDTIFGYPGGAVLPFYDAIYNFKGIRHILGRHEQGC
LHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMCDSVPLLVFTGQVARAGIGKDAFQ
EADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPVVIDLPKDVS

KEGG   T30302 (Metagenome): 2697
Entry
2697              CDS       T30302                                 

Gene name
ilvN
Definition
acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Best hit
hin:HI1584 (best score: 201.83)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2697-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2745:3..347
AA seq 114 aa
AVGDEQVLEQIEKQLHKLVDVFKVINLSEQEHVEREIVLVKVRAVGSSRDEIKRLADIFR
GQIVDVTPKSYTVQLSGTKDKIDAFINALKEEATLLEIVRSGLISLSRGEKNIL

KEGG   T30302 (Metagenome): 17298
Entry
17298             CDS       T30302                                 

Gene name
ilvN
Definition
acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Best hit
vpr:Vpar_1438 (best score: 118.627)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17298-T1-C
LinkDB
Position
C479799:389..661
AA seq 91 aa
MSKVRQHQVLVITKNKPGIGARILSLFNRRGYSVTQMTSGISIPNHHARITLTVETDEVQ
LDQIQKQIYKLIDVIKVKIFSPEQVVRRELM

KEGG   T30302 (Metagenome): 19916
Entry
19916             CDS       T30302                                 

Gene name
ilvN
Definition
acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Best hit
rpne:NCTC8284_01666 (best score: 289.271)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19916-T1-C
LinkDB
Position
C484229:417..908
AA seq 163 aa
MRRILSVLLENESGALSRVVGLFSQRAFNIESLTVAPTDDPTLSRMTIEAVGDEQVLEQI
EKQLHKLVDVFKVINLSEHDYVEREVLLVKVRATGSSRDELKRLADIFRGQIVDVTTKSY
TIQLTGTKDKLDAFVEALKEESTLLEIVRSGLISLSRGEKNIL

KEGG   T30302 (Metagenome): 8832
Entry
8832              CDS       T30302                                 

Gene name
ilvN
Definition
acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Best hit
lba:Lebu_1756 (best score: 102.064)
Taxonomy
Fusobacteria [GN:lba]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8832-T1-C
LinkDB
Position
C461360:3..218
AA seq 71 aa
KVKADVSVRPQIIQLADVYRGNVLDVGPNSIMMEITGETQKLDAFIEIMKEYGILEIAKT
GCTAMSRGEKM

KEGG   T30302 (Metagenome): 1377
Entry
1377              CDS       T30302                                 

Definition
acetolactate synthase II, small subunit
  KO
K11258  acetolactate synthase II small subunit [EC:2.2.1.6]
Best hit
hik:HifGL_000158 (best score: 88.9669)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1377-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1473:complement(331..549)
AA seq 72 aa
MNQYTFDLIAQHRPEVLERVLRVIRLRGFTVINMDMALIEIQVQLKITVKSDRTFDLLVN
QLAKLPDVLNII

KEGG   T30302 (Metagenome): 21393
Entry
21393             CDS       T30302                                 

Definition
putative uncharacterized protein HI_0737
  KO
K11258  acetolactate synthase II small subunit [EC:2.2.1.6]
Best hit
hik:HifGL_000158 (best score: 129.413)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00650  Butanoate metabolism
00660  C5-Branched dibasic acid metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21393-T1-C
LinkDB
Position
C486371:246..464
AA seq 72 aa
MNEYKLELVARHRPEVLERILRVARHRGFTVTTMDMTLIETQVRLKITVKSDRTFDLLVN
QLVKLPDVVEIK

DBGET integrated database retrieval system