KEGG   T30302 (Metagenome): 18773
Entry
18773             CDS       T30302                                 

Gene name
nirD
Definition
nitrite reductase [NAD(P)H], small subunit
  KO
K00363  nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Best hit
rmu:RMDY18_08850 (best score: 171.014)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.18773-T1-C
LinkDB
Position
C482375:complement(423..764)
AA seq 113 aa
MTENAAVASSWVRICPESELEENWGEVALVKGQQYAIFKTKHGYYACDHRDPNSQSLVIA
RGIVGEKDGHSTIASPLYKEVYDLTTGECVSGADYTIGVYPLEVRDGDIYLQV

DBGET integrated database retrieval system