KEGG   T30302 (Metagenome): 18937
Entry
18937             CDS       T30302                                 

Gene name
hfq
Definition
RNA chaperone hfq
  KO
K03666  host factor-I protein
Best hit
hin:HI_0411 (best score: 162.54)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02024  Quorum sensing
03018  RNA degradation
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.18937-T1-C
LinkDB
Position
C482651:complement(50..325)
AA seq 91 aa
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNSSHHVATPEAVESVETQAE

KEGG   T30302 (Metagenome): 6514
Entry
6514              CDS       T30302                                 

Gene name
hfq
Definition
RNA chaperone hfq
  KO
K03666  host factor-I protein
Best hit
hin:HI_0411 (best score: 149.058)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02024  Quorum sensing
03018  RNA degradation
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.6514-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5715:698..982
AA seq 94 aa
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNGGHHAAQTSDAAAEVETQAE

DBGET integrated database retrieval system