KEGG   T30302 (Metagenome): 19191
Entry
19191             CDS       T30302                                 

Definition
hypothetical protein
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Best hit
hin:HI_0604 (best score: 48.9062)
Pathway
00230  Purine metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.19191-T1-C
LinkDB
Position
C483075:1..90
AA seq 29 aa
NFNYPQFYQLQNGEKGRMIVPFQFRLANV

KEGG   T30302 (Metagenome): 18833
Entry
18833             CDS       T30302                                 

Gene name
cyaA
Definition
adenylate cyclase, class-I
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Best hit
hin:HI_0604 (best score: 463.766)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.18833-T1-C
LinkDB
Position
C482485:complement(2..811)
AA seq 270 aa
QYLTALSEFNRLDFVRRCFYVKATKDLALYQADNWRIRYMEILAREWGWSDETVQFLNCR
PLWKIKAVKENHDNVVKFLMLSYRNLVEFARKHRIHSSVVPQDINILSRKLYTAFEAIPG
KVTLLNTQISHNLSEDHITFLEVRGNKHFKDGWYLINQSPNHIMFSKERVIEYGESLNKL
VAWAYFNRLLTEKTNLSIFSKKVSSATLHRFVSNLRVAFPSTVTPQPSNSDLLNQCEIRS
LFIAINLTLDPTANVEEVLTDISSRDLFSF

KEGG   T30302 (Metagenome): 23290
Entry
23290             CDS       T30302                                 

Gene name
cyaA
Definition
adenylate cyclase, class-I
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Best hit
hin:HI_0604 (best score: 1145.18)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.23290-T1-C
LinkDB
Position
C488401:complement(1021..3525)
AA seq 834 aa
LKYDFTQARKCIETLDKRRFDRALLGSGDAFRHIVSLVPLLLHLNHPALPGYVEDALAGI
ADFTLSNYQQNFLSKEHPELVEAVQSTVNSDAVFAQILGIYVMGSFGSISQTSASDLDIW
ICHQDDLSEQEQQRLAEKTKKISQWASTYHVEMHFYLMTQQRFRNERYSDPLTKENSGSA
QYMLLLEEFYRSAVRLAGKPLLWLHLWVEDEKQYEAEVARLVEAGELNLNDWVDFGGLGQ
FSASEYFGASLWQLYKGIDSPYKSVMKILLLETYAQEYPNAQLIARQFKEDLLSGHSTAI
HHFDPYIAILERISQYLTAHSEFKRLDFVRSCFYVKATEDFALYHASNWRISYMKMMAQE
WGWSKERIEELDHRPNWKIKRVKESHNNLVNFLMMSYRNLVDFARKHKINSSVIPQDITV
LSRKLYTAFEELPGKITLLNSQISYNLTEEHLTFIEVHGNKRFKDGWYMVNQPPHHIMFS
KERVIEYGESLNKVVAWAYFNRLLTAETHLHLISQNIDQLTLRNFVADLRLFFPHTNSQV
PTNEALSSQCEIRDLFIAVNLVNDPTAQVEELKSNISPSDLFSFGQLEQSLVGSIDFTYR
NVWNEIRTLHFEGQNAILLALKVLSNKIDQGVNQPRSVQVFCYSKHYNRTLRNLVSVLVN
RCISIQLGDSRPTTHSRLRVAGKNWQFFFEEKGISLQPIEGGKESADNFEDVLPTQLEEK
EIIPEARRYPPEIDLFASEGFLQFFFEDNADNSFNVYLLDEKNRLEIYRQCEGSKDDKVR
EINRIYQSLGSNDCENPYKMVQRNFNYPQFYQLHSTESGMRIMPFKFKSKRTCE

KEGG   T30302 (Metagenome): 17867
Entry
17867             CDS       T30302                                 

Gene name
cyaA
Definition
adenylate cyclase, class-I
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Best hit
hin:HI_0604 (best score: 397.897)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.17867-T1-C
LinkDB
Position
C480817:3..710
AA seq 236 aa
LFSFGAMEQSLVGSIDFTYRNIWNEIRTLHFEGQNAILLALKVLSNKIYRGVNRPDSIQV
YCYSKRYRQDLCQLVSGLVNRCVSIQVGETSLSHSSRLRVAGKNWQFFFEERGISLQEIQ
NDSALDDIKSAVDFDEVLQNPIKDSEMIQESRCYPAEMDAFAREGFLQFFFEDNPDHSFN
VYILDEANRLEIYRRCDGEKDDKVREINQLYQNAKHEGDNNPYNIILRNFNYPQFY

KEGG   T30302 (Metagenome): 20628
Entry
20628             CDS       T30302                                 

Gene name
cyaA
Definition
adenylate cyclase, class-I
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Best hit
hin:HI_0604 (best score: 452.981)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.20628-T1-C
LinkDB
Position
C485307:301..1098
AA seq 266 aa
LEYNLERAKQWVKALDKRRFERALLGSGDAFQHVLSIVPLLLQSNHPQLPGYVIHAPSGV
SGFHISDYQKRWLVNEYGINYADCKYINNQSAVNFRSVLPPILGVYVMGSFGSISQTSSS
DLDTWICVRDGLSSDECALLTKKAKRISEWATQFNVEINFYLVDQQRFRHEHYADSLTAE
NSGSAQYMLLLDEFYRSAVRLAGKPLLWLHLWVESEKDYEKEVERLIESGELDPNDWVDF
GGLGQFSASEYFGASLWQLYKGIDSP

DBGET integrated database retrieval system