KEGG   T30302 (Metagenome): 19199
Entry
19199             CDS       T30302                                 

Gene name
ntcA
Definition
global nitrogen regulator ntcA
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Best hit
rmu:RMDY18_03240 (best score: 169.088)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
02020  Two-component system
02024  Quorum sensing
02025  Biofilm formation - Pseudomonas aeruginosa
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.19199-T1-C
LinkDB
Position
C483089:complement(1..270)
AA seq 90 aa
MDLDILRRSPLFATLDDAAFKLLTDDIQEIDLSRNAVLFYEGDQGDQLFAVLSGKVKLGR
TAADGRENMVALMGPGDVFGEMALFDPSPR

KEGG   T30302 (Metagenome): 16348
Entry
16348             CDS       T30302                                 

Definition
catabolite gene activator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Best hit
hin:HI_0957 (best score: 218.394)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02020  Two-component system
02024  Quorum sensing
02025  Biofilm formation - Pseudomonas aeruginosa
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.16348-T1-C
LinkDB
Position
C477955:263..592
AA seq 110 aa
MSNELTEIDEVVTSSQEEEITQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIK
GSVMVSSKDDEGKEMILTYLGAGQFFGEAGLFDEGSKRSAWVKTKTTCEI

KEGG   T30302 (Metagenome): 6497
Entry
6497              CDS       T30302                                 

Definition
catabolite gene activator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Best hit
hin:HI_0957 (best score: 120.553)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02020  Two-component system
02024  Quorum sensing
02025  Biofilm formation - Pseudomonas aeruginosa
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.6497-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5704:1719..1949
AA seq 77 aa
MSEDVELLEEQKSQDDDQQRDPALDWFLTHCHLHKYPAKSTLIHAGEDANILYFLIKGTV
MVSSKDDEGKEMILSYL

KEGG   T30302 (Metagenome): 14352
Entry
14352             CDS       T30302                                 

Definition
catabolite gene activator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Best hit
hin:HI_0957 (best score: 287.73)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02020  Two-component system
02024  Quorum sensing
02025  Biofilm formation - Pseudomonas aeruginosa
02026  Biofilm formation - Escherichia coli
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.14352-T1-C
LinkDB
Position
C473889:3..461
AA seq 152 aa
EMILSYLGAGQFFGEAGLFDEGSKRSAWVKTKTPCEIAEISYKKYRQLIQINPEILMFLT
AQLSKRLQNTSRQVTNLAFLDVAGRIAQALMHLAKQPEAMTHPDGMQIKITRQEIGQMVG
CSRETVGRIIKMLEDQNLIHAHGKTIVVYGTR

DBGET integrated database retrieval system