KEGG   T30302 (Metagenome): 19302
Entry
19302             CDS       T30302                                 

Definition
cytochrome c oxidase, subunit III
  KO
K02276  cytochrome c oxidase subunit III [EC:7.1.1.9]
Best hit
ach:Achl_1946 (best score: 135.576)
Taxonomy
Actinobacteria [GN:ach]
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19302-T1-C
LinkDB
Position
C483255:598..870
AA seq 91 aa
VTTVTNNPSRPAHPALNRPNTVAIGTVVWLASELMFFAGLFAMYFTLKASRPDIWADNVH
ILNVPFAFINTIVLVLSSVTCQMGVFAAEQL

DBGET integrated database retrieval system