KEGG   T30302 (Metagenome): 19716
Entry
19716             CDS       T30302                                 

Gene name
napB
Definition
nitrate reductase cytochrome c-type subunit (napB)
  KO
K02568  nitrate reductase (cytochrome), electron transfer subunit
Best hit
apl:APL_1426 (best score: 226.483)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.19716-T1-C
LinkDB
Position
C483917:242..670
AA seq 142 aa
MKKSFIFMLALCSGLAFADAPQVANSIDKTAESVAPAFTNPYKDVGNIPVTYPHQPPLVP
HSIRGLQVTKNANQCLGCHSPDVAPTTGAPRVPESHFLTRDGQKTEGTSPRRYFCLQCHV
QQTDVNPIIQNKFETIRQMQGK

KEGG   T30302 (Metagenome): 22875
Entry
22875             CDS       T30302                                 

Gene name
napB
Definition
nitrate reductase cytochrome c-type subunit (napB)
  KO
K02568  nitrate reductase (cytochrome), electron transfer subunit
Best hit
gan:UMN179_01248 (best score: 127.872)
Taxonomy
Gammaproteobacteria - Others [GN:gan]
Pathway
00910  Nitrogen metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016196.22875-T1-C
LinkDB
Position
C488035:complement(1393..1956)
AA seq 187 aa
MKKMMAMIMALLGCSAMLHAEVYPNTNVEVVKSGVENAHEAIQPEFKNNLKDTGIQPRDM
LFAPPVVPHSIKGMQVSKNTNRCLECHNADVAQLVGATVPSKTHFYDREGHLGDTVSARR
YFCLQCHVPQTDAKPIVEQTYRSTPGYDRKADQPLPQVTKTPEYKEKFEETLKEFGHSSD
KYLNQHH

DBGET integrated database retrieval system