KEGG   T30302 (Metagenome): 20036
Entry
20036             CDS       T30302                                 

Definition
aerobic respiration control sensor protein
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Best hit
hit:NTHI0321 (best score: 394.815)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.20036-T1-C
LinkDB
Position
C484425:3..926
AA seq 307 aa
YQVKESRQQSAGSGIGLAISKNLARLMRGDLRVESELGKGSTFYLSIQAEETQINTINHQ
VIPHLHILLVEDVELNVIVAKTILEKLGHRVDVAINGQQAIALFEKNSYDLLLLDIKLPD
MTGFDIAQYLRKNYEEGIYDFLPPMIAFTANVMHSEKDYLEMGMDGVLRKPILIKDLQHC
LQYFFSDESHPIVKIQENDNTEVFDLDLIETLGKAQVLANLDIFKQVMPSYLSKLSVNNL
KETESFSHKIKGAAASVGLIQLHKLAEDLEKAAQVSNKIIIEKWIELMNKNWKDEVDSLI
QFLNYKR

KEGG   T30302 (Metagenome): 22631
Entry
22631             CDS       T30302                                 

Definition
raw score 8.75
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Best hit
rhey:FEE42_12425 (best score: 688.723)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.22631-T1-C
LinkDB
Position
C487767:85..1851
AA seq 588 aa
MKNFRYFAQRYVDWVIRLGRVRFSLLGIAILAILAICIQILLSTLFSDGIHWNDIVRSIT
FGLFTAPFVIYFFTLLVERLERSRLELSKTLARLEKNSRDKSTLLATISHELRTPLNGII
GLSRILLDDKLTEQQQNYLNTINLSAISLGHIFSDIIDLDKIDSNRIELNTQPCDFHSLL
NDFYNFGTLMAEQKGLKFSLRQDENLPNWLYLDRARISQILWNLISNAVKFTDKGEVILT
VQKIQDNQYQFSVTDTGAGIAPYELDKIFTMYYQVKDNIHRSAGSGIGLAISKNLAQLMQ
GDLTVESELNKGSTFYLTIIADKAQANDMNAETAMQHLSILLVEDVELNVVVAKSILEKQ
GHYVDVAMNGEQAIRLFEKNTYDIVFLDIKLPDMSGFDIAYYLRKNYEEGIYDFLPPLIA
FTANVMHSEEEYQNQGMDGVLRKPLSLTELRQCFKTFLGDDIETTSDEEEIPQVQEGINI
SLIELIGKSQAKANVALFKQWMPIYLDELETAYEDYLANSDMQQTVSDVAHKIKGAAASV
GLVNVQNIAKQAQDTSLPNWTSDIASWIKQLSNEWPQNLAELEAYLEK

KEGG   T30302 (Metagenome): 20765
Entry
20765             CDS       T30302                                 

Gene name
arcB
Definition
aerobic respiration control sensor protein arcB homolog
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Best hit
hit:NTHI0321 (best score: 459.144)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.20765-T1-C
LinkDB
Position
C485503:complement(1..894)
AA seq 298 aa
MKNIKHFAQRYVDWVIRLGRIRFSLLGVTILAIFALCTQILFSFFIVHTISWGDIIRSVT
FGLLTAPFVIYFFTLLVERLERSRLELSCSVNRLEKEVNERIIAQQKLSDALEKLEKHNR
DKSTLLATISHELRTPLNGIVGLSQILLDDKLDDKQRNYLKTINISAVSLGYIFSDIIDL
EKIDASRIELNLQPTDFPALLNDIYNFASFLAKQKHLTFHLITEPGLPNYLTLDRVRLSQ
ILWNLISNAVKFTDHGEITLKVSREKDYYYFNVIDTGMGIAPKEQSRIFELYYQVKES

KEGG   T30302 (Metagenome): 20631
Entry
20631             CDS       T30302                                 

Definition
aerobic respiration control sensor protein arcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Best hit
hit:NTHI0321 (best score: 197.978)
Taxonomy
Gammaproteobacteria - Others [GN:hit]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.20631-T1-C
LinkDB
Position
C485309:696..1043
AA seq 115 aa
MNDDNELSEQFDLARIETLGKSKILENLSLFKQTMPNYLAQLSKDKMKETEDTAHKIKGA
AALVGLNHLRQLADALESAAKNSDVFNCGELIDEMGSHWLENVEDLAQFCRTDDK

DBGET integrated database retrieval system