KEGG   T30302 (Metagenome): 20337
Entry
20337             CDS       T30302                                 

Definition
dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Best hit
vpr:Vpar_1266 (best score: 109.768)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00240  Pyrimidine metabolism
00410  beta-Alanine metabolism
00770  Pantothenate and CoA biosynthesis
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.20337-T1-C
LinkDB
Position
C484883:complement(2..274)
AA seq 91 aa
MILIEQGYLVLPTGVMQGTIAIENDTIVEVAPHIEAKPGDVRIDAKGRYVLPGGIDTHTH
FEMTNAFATTADDFESGTKAAIMGGTTTIIN

KEGG   T30302 (Metagenome): 10991
Entry
10991             CDS       T30302                                 

Definition
hypothetical protein
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Best hit
cpy:Cphy_1496 (best score: 126.716)
Taxonomy
Firmicutes - Clostridia [GN:cpy]
Pathway
00240  Pyrimidine metabolism
00410  beta-Alanine metabolism
00770  Pantothenate and CoA biosynthesis
00983  Drug metabolism - other enzymes
01100  Metabolic pathways
Other DBs
HMP: SRS016196.10991-T1-C
LinkDB
Position
C466424:complement(1..375)
AA seq 125 aa
GDTEAKYHPLSKPDTIEAEAMHRFIRLGELADYPVHIVHVSSAAGLDVIEERRKNGAKVT
CETCPQYLLLTDELYNQPDGKGLRYILSPPLRKQRDVEILQAAVERGVFQTLCTDHCNYT
LAQKA

DBGET integrated database retrieval system