KEGG   T30302 (Metagenome): 21466
Entry
21466             CDS       T30302                                 

Definition
inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Best hit
hin:HI0937 (best score: 453.366)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00521  Streptomycin biosynthesis
00562  Inositol phosphate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04070  Phosphatidylinositol signaling system
Other DBs
HMP: SRS016196.21466-T1-C
LinkDB
Position
C486453:539..1330
AA seq 263 aa
MLNIAIRAARKAGNVIAKNYERRDDIQTSKKGINDYVTSVDKAAEAEIIEIIQKSYPDHT
IISEERGALEGKDSDIQWVIDPLDGTTNFVKGLPHFSVSIAIRVKNRTEVGVVYDPIRNE
LFTAVRGEGAKLNEVRLRVDSQNELNGAILATGFPFKQPSLMPTQFAIMNNLIDEAADFR
RTGSAALDLCYVASGRVDGYFEMGLKPWDCAAGDLIVREAGGLVCDFNAGHGYLRSGNIV
AAPARILKEMLNKIQPCLTEQVK

KEGG   T30302 (Metagenome): 22768
Entry
22768             CDS       T30302                                 

Gene name
suhB
Definition
inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Best hit
hin:HI0937 (best score: 503.827)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00521  Streptomycin biosynthesis
00562  Inositol phosphate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04070  Phosphatidylinositol signaling system
Other DBs
HMP: SRS016196.22768-T1-C
LinkDB
Position
C487927:527..1321
AA seq 264 aa
MLNIAIRAARKAGNVIAKNYERRDTIESTQKGINDYVTNVDKAAEAEIIEIIRKSYPDHT
IISEETGALEGKDSDVQWVIDPLDGTRNFMTGLPHFAVSIAIRVKNRTEVGVVYDPIRNE
LFTAVRGEGAKLNEVRLRVDSKREIQGSILATGFPFKQPKLMPTQFAMMNALIEDAADFR
RTGSAALDLCYVASNRIDGYFEMGLKAWDCAAGDLIVREAGGLVCDFDAGNGYLRSGNII
AAPARVLKEMLNKIRPCLGESFND

KEGG   T30302 (Metagenome): 12962
Entry
12962             CDS       T30302                                 

Definition
inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Best hit
spy:SPy_1247 (best score: 171.785)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00521  Streptomycin biosynthesis
00562  Inositol phosphate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04070  Phosphatidylinositol signaling system
Other DBs
HMP: SRS016196.12962-T1-C
LinkDB
Position
C470925:complement(3..434)
AA seq 144 aa
ELGSVWVIDPIDGTANFVAQGYDFAVMVAYYENGIGQFGIIYDVMRDEMYHGGGQFDVKC
NDKVLKPFRNHPLKRFLIASNAGMLERNDWGVADLTKDCLGARAYGSAAISFSRILQGRL
LTYITYLYPWDYAAASILGEKLGY

KEGG   T30302 (Metagenome): 1730
Entry
1730              CDS       T30302                                 

Definition
hypothetical protein
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Best hit
spy:SPy_1247 (best score: 128.257)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00521  Streptomycin biosynthesis
00562  Inositol phosphate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04070  Phosphatidylinositol signaling system
Other DBs
HMP: SRS016196.1730-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1800:1..480
AA seq 159 aa
EQFRLLRKKGKGRFLLESKFEFAKELVKRAGQYILDHMQEDLCVETKSSPTDLVTRLDKE
VQELLVGEILSRYPEDKICAEEGCLRASVQEGKVWVIDPIDGTNNFVAQQEDFAVMMAYF
ENGQGQFGLIYDVIKGDCYHGGXXXXXPLVLPRFCQGVC

KEGG   T30302 (Metagenome): 3359
Entry
3359              CDS       T30302                                 

Definition
inositol monophosphatase family protein
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Best hit
spy:SPy_1247 (best score: 68.5514)
Pathway
00521  Streptomycin biosynthesis
00562  Inositol phosphate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
04070  Phosphatidylinositol signaling system
Other DBs
HMP: SRS016196.3359-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3364:complement(2..313)
AA seq 104 aa
GDCYHGGGAFPVYLNDKPLAPFKAKPLGDFLIAGNSGMLETNEWGLADLARAXXXXXLQP
WDYAAASILGEGLGYRVVTLSGEPLDFQTRQPVMMVPLEMQEEI

DBGET integrated database retrieval system