KEGG   T30302 (Metagenome): 21680
Entry
21680             CDS       T30302                                 

Gene name
dksA
Definition
RNA polymerase-binding protein dksA
  KO
K06204  DnaK suppressor protein
Best hit
hin:HI_0062 (best score: 276.559)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.21680-T1-C
LinkDB
Position
C486715:961..1398
AA seq 145 aa
MSKASLSLLDLAGVTPYQPKKDEEYMNEDQILHFRKILTAWHEQIVEEASRTVAHMQDEA
SNFPDPADRATQEEEFSLELRNRDRERKLMKKIEYTLKKLDTDDFGYCDSCGEEIGIRRL
EARPTADLCIDCKTLAEIREKQVAG

KEGG   T30302 (Metagenome): 7838
Entry
7838              CDS       T30302                                 

Gene name
dksA
Definition
RNA polymerase-binding protein dksA
  KO
K06204  DnaK suppressor protein
Best hit
apl:APL_0175 mht:D648_19080 (best score: 194.512)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.7838-T1-C
LinkDB
Position
C458993:1..312
AA seq 104 aa
AWHSQIMDEAVRTKNQMQEDVTNFADPADRATQEEEFSLELRNRDRERKLLKKIEQTLHK
ISDDDYGYCETCGVEIGLKRLEARPTADLCIDCKTLAEIREKQL

DBGET integrated database retrieval system