KEGG   T30302 (Metagenome): 21738
Entry
21738             CDS       T30302                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rpne:NCTC8284_01131 (best score: 119.398)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21738-T1-C
LinkDB
Position
C486789:complement(2..178)
AA seq 59 aa
MVTRRQLANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPNNPKWADRDR

KEGG   T30302 (Metagenome): 1470
Entry
1470              CDS       T30302                                 

Definition
probable transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_12740 (best score: 86.6557)
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1470-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1540:complement(356..544)
AA seq 62 aa
PDAVRCRVAVEMGATQNWYKYVGLDGAVLGIDTFGASAPAPKVLAEYGFTVENLVKVVQN
LK

KEGG   T30302 (Metagenome): 4966
Entry
4966              CDS       T30302                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
hin:HI1023 (best score: 213.386)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.4966-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4681:3..356
AA seq 117 aa
EGTPELIFIATGSEVELAVKAAEALSAEGKKVRVVSMPSTNRFDKQDAAYRESVLPTAVT
KRVAIEAGIADFWYKYVGFEGRVVGMNSFGESAPADQLFKLFGFTVDNVVAKAKEIL

KEGG   T30302 (Metagenome): 1793
Entry
1793              CDS       T30302                                 

Definition
probable transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
got:AXE85_05400 (best score: 196.052)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1793-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1859:1..447
AA seq 149 aa
RFLGIDAINKANSGHPGVVMGAAPMAYSLFTKQLRINPAQPNWINRDRFILSAGHGSMLL
YALLHLSVLKMLAWMRLRASVSGVQKHQXXXXXXXAAKYNREGYNIFDHYTYVICGDGDL
MEGVSSEAASYAGLQKLDKLVVLYDSNDI

KEGG   T30302 (Metagenome): 12363
Entry
12363             CDS       T30302                                 

Gene name
tkt
Definition
probable transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
got:AXE85_05400 (best score: 181.8)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12363-T1-C
LinkDB
Position
C469599:complement(2..316)
AA seq 105 aa
MSNLSVNAIRFLGVDAINQANSGHPGVVMGAAPMGYTLFTKQIHVNPEVPNWINRDRFVL
SAGHGSMLLYALLHLSGFKDLSIEELKQFRQWGSKTPGHPEFGHT

KEGG   T30302 (Metagenome): 16336
Entry
16336             CDS       T30302                                 

Gene name
tktA
Definition
transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rpne:NCTC8284_01131 (best score: 124.02)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16336-T1-C
LinkDB
Position
C477929:415..591
AA seq 59 aa
MATRRQLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPNNPKWADRDR

KEGG   T30302 (Metagenome): 14648
Entry
14648             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0805 (best score: 292.737)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14648-T1-C
LinkDB
Position
C474519:1..501
AA seq 167 aa
QEKAKAIRVNIVKAVTAAKSGHPGGSLSIADVMSLLYFQEMNVNPNEPKDPNRDRFVLSK
GHAAPALYATLAEKGFFPTKELLNLRKIDHILQGHPDMKYIPGVDMSTGSLGQGISAACG
MALAGKIDGASYRVYSVLGDGELEEGQVWEAAMFAAHYKLSNLTAFV

KEGG   T30302 (Metagenome): 2770
Entry
2770              CDS       T30302                                 

Gene name
tkt
Definition
probable transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
got:AXE85_05400 (best score: 194.512)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2770-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2804:complement(2..322)
AA seq 107 aa
AVLPTFFGGSADLSHSNMTFIKGDNLQDDSHRTERNVQFGVREFAMATVLNGLMLHGGVR
VFGGTFFVFSDYLKGALRLSALQNLPVTYVFTHDSIAVGEDGPTHEP

KEGG   T30302 (Metagenome): 17482
Entry
17482             CDS       T30302                                 

Definition
transketolase, pyridine binding domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
vpr:Vpar_0806 (best score: 370.933)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17482-T1-C
LinkDB
Position
C480143:2..676
AA seq 225 aa
AYGTALVKVGATHKDVVVLDADLSKSTKTDEFKKVYPERFFNVGIAEQNLISVGAGLAAA
GKVPFVSSFAMFATGRAFEQVRNAVCYPKLNVKVCATHAGITVGEDGATHQSLEDISCMR
TLPNMTVVVPADAAETEAVIAWAAEYHGPVYVRLGRAGVEDVTPEGYTFVPGKSQQLRDG
KDATIIACGALVGPAVEAAATLEAEGISVRVINMASIKPIDGEAI

KEGG   T30302 (Metagenome): 4744
Entry
4744              CDS       T30302                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
hin:HI1023 (best score: 332.028)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.4744-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4491:3..509
AA seq 169 aa
KSWEEKFAAYAKAYPELAAEFTRRVNGELPANWAAESKAFIEKLQANPASIASRKASQNA
IEAYAHVLPEFLGGSADLASSNLTLWSGSKPIRAHENVGGNYLNYGVREFGMSAIMNGIA
LHGGFIPYGATFLMFYEYAHNAVRMAALMKQRALFVYTHDSIGLGEDGP

KEGG   T30302 (Metagenome): 6489
Entry
6489              CDS       T30302                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
got:AXE85_05400 (best score: 299.286)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6489-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5702:1..633
AA seq 211 aa
DICLDGETKDAFSENVRARYEAYGWNTILVEDGANVEEVNSAIEQAKKSDKPTLIEVKTI
IGAGSPNRQGTNGVHGAPLGEEETALFRKEIGWENEPFDIPADVYADFKANVADRGESEY
VKWEKLYADYKAAYPELAKELEEVLSREDISRLSKESFSFKNVGEAQATRNSSQDAINSV
AAVLPTFXXXXXNSIKWINATWWCTCIRWYI

KEGG   T30302 (Metagenome): 3568
Entry
3568              CDS       T30302                                 

Gene name
tktC
Definition
transketolase c-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_11065 (best score: 301.982)
Taxonomy
Firmicutes - Bacilli [GN:bths]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3568-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3562:4713..5645
AA seq 310 aa
MMRSAKELRHVYRDFLLEANQSYSDIVVLEADLSSSMATNNLEKDFGDRYVNVGIMEAEM
VGLAAGLSIQGFRPYLHTFGPFASRRVFDQLFISLGYAQLDATVIGSDAGVTAEMNGGTH
MPFEEIGLLRLIPKSIIFEATDDIQFREILNQTLELKGLKYIRTIRKAPEAVYQGGEDFS
KGYIELRHGEDVVIVASGIMVAPSIRVADELSKLGYSVGVIDLFRIKPIPEQIKTMLSGK
TIFTVENHNQIGGIGSALCELFSDDGITKIHRMGVQERFGQVGKMDYLLNEYGLSESNIK
EKVLAFYNAR

KEGG   T30302 (Metagenome): 2695
Entry
2695              CDS       T30302                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
hin:HI1023 (best score: 194.897)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2695-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2742:3..314
AA seq 103 aa
VELAVKAAEALSAEGKKVRVVSMPSTNRFDKQDETYRESVLPAAVTKRVAIEAGISDFWY
KYVGFNGRVIGMNSFGESAPADQLFKLFGFTVENVVAKAKEIL

KEGG   T30302 (Metagenome): 6728
Entry
6728              CDS       T30302                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
got:AXE85_05400 (best score: 367.081)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.6728-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5817:complement(2..577)
AA seq 192 aa
MSQKSVNAIKVLGVDAINKAKSGHPGVVMGAAPMAYSLFTKHLRVNPKKTDWINRDRFVL
SAGHGSMLLYSLLHLSGFEDVSLEEVKNFRQWGSKTPGHPEFGHTKGIDATTGPLGQGIS
TAVGMALAERYLAAKYNKEGYDLFDHYTYVICGDGDIMEGVASEASSFAAVQKLNKLVVL
YDSNDICLDGET

KEGG   T30302 (Metagenome): 9327
Entry
9327              CDS       T30302                                 

Gene name
tktA
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
hin:HI1023 (best score: 230.72)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9327-T1-C
LinkDB
Position
C462510:complement(2..337)
AA seq 112 aa
QNAIEAYAHVLPEFLGGSADLASSNLTLWSGSKPIRAHENVGGNYINYGVREFGMSAIMN
GIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRSLFVYTHDSIGLGEDGP

KEGG   T30302 (Metagenome): 18470
Entry
18470             CDS       T30302                                 

Gene name
tkt
Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rmu:RMDY18_10930 (best score: 248.44)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18470-T1-C
LinkDB
Position
C481835:3..446
AA seq 147 aa
IHSDTEGEKFASAEGTARGGYVMADTEGTPDVILIATGSEVEIALEARHKLSEKGIAARV
VSMPSREWFNEQSDEYRESVLPSSVAARVSVEAGLGMSWYDLLGSAGRAVSIEHFGASAD
AKTLYREFGITPETVVTAAEESIVAAK

KEGG   T30302 (Metagenome): 3567
Entry
3567              CDS       T30302                                 

Gene name
tktN
Definition
transketolase n-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
bths:CNY62_11060 (best score: 332.413)
Taxonomy
Firmicutes - Bacilli [GN:bths]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3567-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3562:3859..4716
AA seq 285 aa
MILSENREDELRKFATKIRLNTLRTLNHLGFGHYGGSLSIVEVLAVLYGEIMPMTPEIFA
SRDRDYFVLSKGHAGPALYSTLYLNGFFDKEFLHSLNTNGTKLPSHPDRNLTPGIDMTTG
SLGQGISVATGLAYGQRIRKSPFYTYAIVGDGELNEGQCWEAIQFASHQQLSNLIVFVDD
NKKQLDGFTKDICNPGDFVEKFSAFGFESIRVNGSDIREIYEGIIQLKQSNNSSPKCIVL
DTIKGQGVRELEEMKSNHHLRPTVEERQMLTSVVERLSQELEETE

KEGG   T30302 (Metagenome): 9813
Entry
9813              CDS       T30302                                 

Definition
transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Best hit
rmu:RMDY18_10930 (best score: 199.519)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00710  Carbon fixation in photosynthetic organisms
01051  Biosynthesis of ansamycins
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9813-T1-C
LinkDB
Position
C463714:complement(1..348)
AA seq 116 aa
GNYVEDVQELYNAIERAKTVTDKPSFIEVRTIIGYPAPNKQNTGSVHGSKLGAEEIVETK
KVLGFDPEKSFFIEDEVLAHTRELRERGAAAHKVWNEKFEAWAQANPERAKLYNRL

DBGET integrated database retrieval system