KEGG   T30302 (Metagenome): 21825
Entry
21825             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 571.237)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.21825-T1-C
LinkDB
Position
C486903:complement(2..967)
AA seq 322 aa
VFFGVTGDLARKKLLPAVYDLMNRGLLPPSFGLVGYGRREWDNDDFRNYVRKSVEENART
PFREDVWNQFQKGMRFVRGNFDDDAAFKRLKETLEELDKRGAQGNHAFYLSIPPKAFEQV
LSKLAEHGLASRDDVAVDDSLMNGWRRVVIEKPFGHDLESARELNAIVERVFPPDSVFRI
DHYLGKETVQNILAMRFSNQMFEPVWNANYVDHVQITMAEDIGIGSRAGYYDGVGAARDV
IQNHLLQLLALTAMEEPLSLDSKHLRAEKAKVLEAVRIDDLENSFALGQYAPGYQGGEHV
NGFFDEKDIPADSRTETFAALK

KEGG   T30302 (Metagenome): 15258
Entry
15258             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
hin:HI0558 (best score: 359.762)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.15258-T1-C
LinkDB
Position
C475787:1..531
AA seq 177 aa
VLRFSNGWFEPLWNRNFIDYVEITGAESIGVEERGGYYDGSGAMRDMFQNHLLQVLAMVA
MEPPAIINANSMRDEVAKVMHSLRPLTVEDMEHNLVLGQYTAAEINGKMEKGYLEEKGVP
ADSRTETYIALRCEIENWRWAGVPFYVRTGKRLPARVTEIVIHFKTTPHPVFSQNAP

KEGG   T30302 (Metagenome): 15736
Entry
15736             CDS       T30302                                 

Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
vbc:C5Q97_18455 (best score: 60.4622)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.15736-T1-C
LinkDB
Position
C476803:complement(2..169)
AA seq 56 aa
MNVSYNVKEELCIEHTPGAGAIVIFGASGDLTKRKLLPAIYSLFQRGLLSPKVAVV

KEGG   T30302 (Metagenome): 11861
Entry
11861             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 234.572)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.11861-T1-C
LinkDB
Position
C468437:complement(1..399)
AA seq 133 aa
FAEKLGVEERGGYYDESGALRDMVQNHTLQLLSLLAMDKPNSFTKDEIRAEKIKVFERLT
QPDQEDLKKYFIRGQYKSGKVNGKKYISYRSEPNVNPESMTETFVSGAFFVDSDRFRDVP
FFFRTGKRLTEKG

KEGG   T30302 (Metagenome): 7971
Entry
7971              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 184.111)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.7971-T1-C
LinkDB
Position
C459289:1..312
AA seq 104 aa
PFYLRAGKRLGRRVTEIALLFKKSSDRLFGKETEVPAGQNAIVIRVQPDEGMTIRLAAKV
PGTQMEIRDVNMDFGYGHAFTEASPEAYERLILDVLLGEPPLFP

KEGG   T30302 (Metagenome): 492
Entry
492               CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 192.971)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.492-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_574:complement(743..1021)
AA seq 92 aa
ATATGASPEPYEKLIYDVLNNNSTNFSHWDEVGASWKLIDRIEELWAENGAPLHDYKAGS
MGPQASFDLLEKFGAKWTWQPDIAYRQDGRLE

KEGG   T30302 (Metagenome): 449
Entry
449               CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 166.392)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.449-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_541:498..749
AA seq 84 aa
MSSKVIVTIFGASGDLAKRKLYPSLFRLYKSGNLSEHFAVIGTARRPWSKEYFESVVVES
ILDLADSTEQAQEFASHFYYQSHD

KEGG   T30302 (Metagenome): 10502
Entry
10502             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
got:AXE85_01790 (best score: 211.846)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.10502-T1-C
LinkDB
Position
C465308:1..363
AA seq 121 aa
EQNIPADSKTETYAALKLFVDNERWQGVPFFIRTGKKLEKRETQVVVQFKAVGSSPGNVL
IIKIQPEEGVYFQFNAKKPGTEQELQPISLDFCQSCILENIVNTPEAYERLLDACFREDR
A

KEGG   T30302 (Metagenome): 8015
Entry
8015              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
dtn:DTL3_0867 (best score: 108.997)
Taxonomy
Thermotogae [GN:dtn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.8015-T1-C
LinkDB
Position
C459390:complement(1..315)
AA seq 105 aa
IFKPFHAKDFNQNVLVLRMQPNEGMGLSLEVKSPGSKLSVNTLEMDFSYSNSKELADIPD
AYERLILDGLLGDQTLFVRNDAVEKSWRLFKPLIEAWERNDEETP

KEGG   T30302 (Metagenome): 2678
Entry
2678              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
got:AXE85_01790 (best score: 306.605)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.2678-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2721:complement(2..586)
AA seq 195 aa
EVITMTGLETMKNKTAITLFGGTGDLTYRKLLPALYNLNALGKLADDFKIVVIGRRAYTQ
SDYIDIARTWVKEYARTKFDDAQFDAYAKRIIYFKMDMTNEDDYELLQNFYVEQDIQDHV
YYFAVAPSFFITITNGLKKYCSENNAKVIIEKPFGEDLEKAGLLNDELAKFFDENEIYHI
DHYLGKEMIQNILSL

KEGG   T30302 (Metagenome): 15744
Entry
15744             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
got:AXE85_01790 (best score: 66.6254)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.15744-T1-C
LinkDB
Position
C476813:complement(441..560)
AA seq 39 aa
WTFVNKLIDKYEEQGAPLYTYEQGSKGPKEADKLVNWVR

KEGG   T30302 (Metagenome): 5836
Entry
5836              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 244.588)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.5836-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5320:complement(3..368)
AA seq 122 aa
ASKLNDELLATFDEEQIFRIDHYLGKEMIQSIFAVRFANLIFENVWNKDFIDNVQITFAE
RLGVEERGGYYDESGALRDMVQNHTLQLLSLLAMDKPASFTKDEIRAEKIKVFKNLYHPT
DE

KEGG   T30302 (Metagenome): 17558
Entry
17558             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
hin:HI0558 (best score: 409.838)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.17558-T1-C
LinkDB
Position
C480281:87..683
AA seq 199 aa
MQTDNNCIVIFGASGDLTHRKLIPALYNLYKIGRLSENFSVLGVARSELNDETFREKMRE
ALIHNEETTPETLDAFCSHLYYQAVNTSDAQDYGKLVPRLDDLHDKYKTCGNTLYYMSTP
PSLYGVIPECLAAHGLNTEEYGWKRIIVEKPFGYDEKTAQALDVQIHRFFEEHQIYRIDH
YLGKETVQNLLVLRFSNGW

KEGG   T30302 (Metagenome): 10615
Entry
10615             CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 126.331)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.10615-T1-C
LinkDB
Position
C465574:1..177
AA seq 58 aa
PPLFPRHEEVELSWKILDPFEKYWEENKIKPEPYESGSWGPRSAQKMLERDNRAWRRP

KEGG   T30302 (Metagenome): 4278
Entry
4278              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
hin:HI0558 (best score: 909.057)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.4278-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4139:84..1565
AA seq 493 aa
MQTNNNCIVIFGASGDLTHRKLIPALYNLFKFGRLNQFSVLGVARTELNDDTFREKMREA
LLETEETTPETLEEFCNHLYYQAVNTSDAADYGKLVPRLDELHNKYQTNGNTLYYMSTPP
SLYGVIPECLAAHGLNTEENGWKRIIVEKPFGYDEKTAQELDVQIHRFFEEHQIYRIDHY
LGKETVQNLLVLRFSNGLFEPLWNRNYIDYVEITGAEAIGVEERGGYYDGSGAMRDMFQN
HLLQVLAMVAMEPPAIINANSMRDEVAKVMHSLRPLTQDDVEHNLVLGQYIAAEIDGKEV
KGYLQEKGVPSNSRTETFMALRCEIENWRWAGVPFYVRTGKRLPARVTEIVIHFKTTPHP
VFSQNAPENKLIIRIQPDEAISMRFGLKKPGAGFEAKEVSMDFRYADLADDQVLTAYERL
LLDAMKGDATLFARTDAVHAAWKFVQPILDYKEAGGRVHEYEAGTWGPVAAEKLIAKSGR
VWRKPSGKMKKKV

KEGG   T30302 (Metagenome): 8959
Entry
8959              CDS       T30302                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
tro:trd_1143 (best score: 136.732)
Taxonomy
Chloroflexi [GN:tro]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.8959-T1-C
LinkDB
Position
C461660:complement(2..331)
AA seq 110 aa
LSLIAMEPPASFNADDYRDEIAKLISSIRGLHRQKLGDIAVRGQYTDSGNTERPAPEYRK
EENVPPTSTTETYVALKLFIDNWRWRDVPFYLRTGKRLPKKSSEIAITFK

DBGET integrated database retrieval system