KEGG   T30302 (Metagenome): 22552
Entry
22552             CDS       T30302                                 

Gene name
rfaL
Definition
O-antigen polymerase (rfal protein)
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Best hit
aap:NT05HA_1726 (best score: 250.366)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.22552-T1-C
LinkDB
Position
C487687:284..1540
AA seq 418 aa
MLNIGNSPKLFINASIFLFFTLLLMFPKGYNYGSTALLVLSILFLCYLLYKRVNFLEVVK
QNKVIFVVTTFYFLVSLFFIFFHGEKIKLIDNPLRAFLFLSVIVSIVYSSVKFDILLYSI
PLGSFISGVVALYQYYILSLESAFYNQMKIQSGDIAMSLGLFSFVIAFHLLDVNKHKKKL
VALVIFFGIFGVLASLLSFARGGWVGIPILLLILIFLYRHLLSKKLLLLGGITFLCIISV
VLTTNNKLVNRLSEAQYELKLYLSGDDKVSSIGERLDMWKIGSKAFLEHPISGWSLKELD
YYKKDLSDKNIVTKASISFSHLHNQFIDELAKKGILGGVAILGIFLVPLCSFYRKQKKFL
NNKKIKLLTTLGIVHVLSTMSYCLTQAFLTHNSGNIFYFFVLFLFYAFMVNESATTSE

KEGG   T30302 (Metagenome): 19501
Entry
19501             CDS       T30302                                 

Gene name
rfaL
Definition
uncharacterized protein HI_0874
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Best hit
fcl:A4G17_00715 (best score: 139.428)
Taxonomy
Gammaproteobacteria - Others [GN:fcl]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19501-T1-C
LinkDB
Position
C483587:complement(3..617)
AA seq 205 aa
VYRKEKYLKLFINTSIFCFFTLLLVFPKGYNYGSTALLVASVLFVFYSIYKKFKIKEIIK
QNNPIFFVVSLYFLIALFFIILHGDKFKLIDNPLRAFLFLSVIIFVIYTKIKFDVLLYSI
PVGSFVAGLVALYQYYVLHLPSAFGEQMKIQSGDIAMSLGLFNFIIALYLFDIKKNRFAL
VTVIAGLFGVLASVLSLARGGWVGV

KEGG   T30302 (Metagenome): 21461
Entry
21461             CDS       T30302                                 

Gene name
rfaL
Definition
O-antigen polymerase (rfal protein)
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Best hit
msu:MS0243 (best score: 119.398)
Taxonomy
Gammaproteobacteria - Others [GN:msu]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.21461-T1-C
LinkDB
Position
C486449:1..393
AA seq 130 aa
HPISGWNLNELDEYKKELADKGIVSHEFIGFSHFHNQFIDELAKKGILGGVAIFGIFLVP
LCSFYRKQKRFSKNKKVKLLTTLGIIHVLATMSYCLTQTFLAHNSGNIFYFFVLIIFYAL
MVNNCPVQNK

DBGET integrated database retrieval system