KEGG   T30302 (Metagenome): 23086
Entry
23086             CDS       T30302                                 

Gene name
arcA
Definition
aerobic respiration control protein arcA homolog
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Best hit
hin:HI_0884 (best score: 332.798)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.23086-T1-C
LinkDB
Position
C488243:1..561
AA seq 186 aa
VLDINLPGKNGLLLGRELREKTAIPLIFLTGRDNEVDKILGLEIGADDYLTKPFNPRELT
IRARNLLHRTMTLNGKETHLQRENYRFNGWTLDLNSHNLITPEGGEFKLPRSEFRAMLHF
CENPGKLQTREELLQKMTGRELKPQDRTVDVTIRRIRKHFEDHPNTPEIIATVHGEGYRF
CGELEE

KEGG   T30302 (Metagenome): 19082
Entry
19082             CDS       T30302                                 

Gene name
arcA
Definition
aerobic respiration control protein arcA homolog
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Best hit
hin:HI_0884 (best score: 422.935)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
02020  Two-component system
02026  Biofilm formation - Escherichia coli
Other DBs
HMP: SRS016196.19082-T1-C
LinkDB
Position
C482883:complement(97..807)
AA seq 236 aa
MATPKILIVEDEIVTRNTLKGIFEAEGYDVLEAQDGAEMHHILTHYTINLVVMDINLPGK
NGLLLARELRENINLPLIFLTGRDNEVDKILGLEIGADDYLTKPFNPRELTIRARNLLHR
TLPHQEKENTSGKEFYRFNGWVLDLNSHNLITPENQELKLPRSEFRAMLYFCENPGKLLT
REELLRKMTGRAFKPQDRTVDVTIRRIRKHFEEYSNTDEIIMTVHGEGYRFCGNIE

DBGET integrated database retrieval system