KEGG   T30302 (Metagenome): 2638
Entry
2638              CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
got:AXE85_01735 (best score: 183.341)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2638-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2686:3..350
AA seq 116 aa
NRNKDDVPMIIPEINSAHLDVLPAQRERLGTKKGFIVTKPNCSXXXXENIIPYIGGEEEK
SEKEPLKIFGKVVDGKIVPDNSMKLSAQCIRVPVLDGHLACVSFNLENDPGLETLV

KEGG   T30302 (Metagenome): 17160
Entry
17160             CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
hin:HI0646 (best score: 352.443)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17160-T1-C
LinkDB
Position
C479547:complement(2..529)
AA seq 176 aa
MKNVGFIGWRGMVGSVLMDRMSQENDFANLNPVFFTTSQAGQKAPVFGGKDAGELKNAFD
IEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVI
SEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWVSVATYQAASGAGAKNMREL

KEGG   T30302 (Metagenome): 14972
Entry
14972             CDS       T30302                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 286.574)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14972-T1-C
LinkDB
Position
C475193:3..518
AA seq 172 aa
EIDRKVLAKQRSGELDTAQFGVPLSGSLIPWIDSDLGNGQSREEWKSDAETNKILGLEGG
NRVIMDGLCVRIAAMRSHSQALTMKLTEDLPVAEIERIIAEDNQWAQVVPNTKDATMEGL
TPVAASGSLDIPVGRIRKLAMGPQYISAFTVGDQLLWGAAEPVRRMLKIAVG

KEGG   T30302 (Metagenome): 15701
Entry
15701             CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 115.161)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15701-T1-C
LinkDB
Position
C476733:complement(366..554)
AA seq 62 aa
AAQEYPMPLYTSNQNDCEIGRIRKDLFNEHAMNFWIVGDQIRKGAALNALQIAEYLVEHQ
SF

KEGG   T30302 (Metagenome): 3632
Entry
3632              CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
bhud:A6A11_08860 (best score: 206.453)
Taxonomy
Gammaproteobacteria - Others [GN:bhud]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3632-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3627:1..303
AA seq 101 aa
GQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIL
ASHNEWVKVIPNDKETTLRELTPAKVTGTLSVPVGRLRKLA

KEGG   T30302 (Metagenome): 1542
Entry
1542              CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
got:AXE85_01735 (best score: 175.637)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1542-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1630:114..416
AA seq 101 aa
MQKSRVAVLGATGMVGQRLLVLLENHPYFDVVKLAASPRSAGKKYGELMESRWKLDHAVP
EYTKELVVEDLYKIDEVSEGIDMVFCAINLDKESLIKLEED

KEGG   T30302 (Metagenome): 9833
Entry
9833              CDS       T30302                                 

Definition
hypothetical protein
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 184.882)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9833-T1-C
LinkDB
Position
C463758:complement(2..349)
AA seq 116 aa
AQHVAGEDMVANLLPTGSMDKHYAIAFNLIPQIDVFMENGYSKEEMKMVLETQKIFHDDT
IAVVPTTVRVPVYRSHSESVLVKTESPVSVEDFKAACEKFPGLRVNDNPAAQEYPM

KEGG   T30302 (Metagenome): 18345
Entry
18345             CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
hin:HI0646 (best score: 348.591)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18345-T1-C
LinkDB
Position
C481627:227..754
AA seq 176 aa
MKNVGFIGWRGMVGSVLMDRMSQENDFANLNPVFFTTSQAGQKAPVFAGKEAGELKNAFD
IEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVI
SEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWVSVATYQAASGAGAKNMREL

KEGG   T30302 (Metagenome): 14594
Entry
14594             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
msu:MS0006 hin:HI0646 rpne:NCTC8284_03949 (best score: 43.1282)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14594-T1-C
LinkDB
Position
C474409:complement(437..499)
AA seq 20 aa
DQLLWGAAEPVRRILKQLVA

KEGG   T30302 (Metagenome): 5860
Entry
5860              CDS       T30302                                 

Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
rmu:RMDY18_04100 (best score: 276.559)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5860-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5336:complement(2..457)
AA seq 152 aa
MNFNPGDSVGFVGWRGMVGSVLMKRMLEENDFNDISPVFFTTSNVGGEAPTFDGTLEPST
LKDAYDLNELRQHKIIVTAQGGDYTKEVHPKLRESGWEGLWIDAASALRMNDDAIIVLDP
INRDVIDRGLESGVKDFIGGNCTVSCLLMGLG

KEGG   T30302 (Metagenome): 14626
Entry
14626             CDS       T30302                                 

Gene name
asd
Definition
aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Best hit
vpr:Vpar_0929 (best score: 283.878)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.14626-T1-C
LinkDB
Position
C474469:complement(3..500)
AA seq 166 aa
TGAVGQEFITLIEERKFPYESIKLLASARSAGKVLTVDGKEYVVEEAKPESFEGVDIALF
AGGSISKTLAPEAAKRGAIVIDNSSAFRMDPDVPLVVPEVNPEDIDTHKGIIANPNCSTI
IMALGLKPLHDLSPIKRVVVSTYQAVSGAGKEGIEELDSQVAQHVA

DBGET integrated database retrieval system