KEGG   T30302 (Metagenome): 2953
Entry
2953              CDS       T30302                                 

Gene name
atpH
Definition
ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Best hit
spy:SPy_0757 (best score: 94.7449)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2953-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2992:3..371
AA seq 122 aa
SDKEKTIAFFQDSVSPLLQNLIQVLIYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAH
PLTDEQKSRLLPLIEKKMSLKVRSVKEEIDESLIGGFVIFANHKTIDVSIKQQLKVVKEN
LK

KEGG   T30302 (Metagenome): 19467
Entry
19467             CDS       T30302                                 

Gene name
atpH
Definition
ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Best hit
rmu:RMDY18_12880 (best score: 305.834)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19467-T1-C
LinkDB
Position
C483531:complement(242..892)
AA seq 216 aa
KDRENIAQAIFSGKISSQALKVLTTAVALRWSQERDLADALEKAAVLASIASAQSRGGAD
ALEEVTNELLTFVRNVDGTPEAQAALSDNLASKEAKKKLAVALGGPAVTAEGVLLLERIG
SESRGHHAARLADEFVEIIVTRQNRYIAKVTSAVALSQAQLERLSRTLNKIYNRQLKLDV
SIDTAVLGGMRVQIGDEVIDGTVGTRLDDLERDLQA

KEGG   T30302 (Metagenome): 1935
Entry
1935              CDS       T30302                                 

Gene name
atpH
Definition
ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Best hit
hin:HI_0482 (best score: 116.316)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.1935-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2001:1..192
AA seq 63 aa
QPLNATQIEKIAAAMEKRLARKVKLNCNVDSSLIAGVVIRTEDFVIDGSSRGQLARLANE
LQL

KEGG   T30302 (Metagenome): 14071
Entry
14071             CDS       T30302                                 

Gene name
atpH
Definition
ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Best hit
hin:HI_0482 (best score: 167.162)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14071-T1-C
LinkDB
Position
C473277:complement(3..263)
AA seq 87 aa
MSELTTIARPYAKAAFDFAIEQSAVEKWTDMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLS

KEGG   T30302 (Metagenome): 12081
Entry
12081             CDS       T30302                                 

Gene name
atpH
Definition
ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Best hit
got:AXE85_07455 (best score: 139.043)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.12081-T1-C
LinkDB
Position
C468971:complement(64..405)
AA seq 113 aa
AGVNKYVVNVVKILAGNLQISLINFVLEQFTELFNKHSNSVVVKVESASPLTEVQLENLK
EKLKNELQLEKVELNNLVDKSLLGGLKLTYNNKVVDASVRAKLNAIKSKISTI

DBGET integrated database retrieval system