KEGG   T30302 (Metagenome): 3534
Entry
3534              CDS       T30302                                 

Definition
mazG family protein
  KO
K04765  nucleoside triphosphate diphosphatase [EC:3.6.1.9]
Best hit
rpne:NCTC8284_00085 (best score: 189.889)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00760  Nicotinate and nicotinamide metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.3534-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3540:complement(21..383)
AA seq 120 aa
LLRAQKMQKQCSKIGFDWNELEPVLAKVEEELQEVRDEVNQMPRNQEKIEEEIGDLFFAM
VNLSRHLKCNAEEALRKANNKFEQRFRKVEEKALERGSSVKDLSLIEMDILWDEVKREER

KEGG   T30302 (Metagenome): 23255
Entry
23255             CDS       T30302                                 

Gene name
mazG
Definition
nucleoside triphosphate pyrophosphohydrolase
  KO
K04765  nucleoside triphosphate diphosphatase [EC:3.6.1.9]
Best hit
hin:HI0460 (best score: 509.22)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00240  Pyrimidine metabolism
00760  Nicotinate and nicotinamide metabolism
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.23255-T1-C
LinkDB
Position
C488379:complement(93..884)
AA seq 263 aa
MHYSIQDFIQLIAQLRNPNSGCPWDLKQNYESMIPCLTEETYEVIEAIEKKDIPNLREEL
GDLLLQVVFFSQLATEDKYFTFDDVLQDVAEKIVRRHPHVFGDAKAGDETEALSRWNEMK
AKEKQGKSEETSILDNVPRALPSLTRAAKLQKRCSKVGFDWEEISPVFDKVQEELEEVQA
EINRTSIDQNKVEEEMGDLLFATVNLARHLKCDPEDALRKANLKFERRFRAVEQAVQQQG
KQVNDVPLIELDLLWDEVKKQEN

DBGET integrated database retrieval system