KEGG   T30302 (Metagenome): 385
Entry
385               CDS       T30302                                 

Gene name
ldh
Definition
L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
got:AXE85_00720 (best score: 558.14)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.385-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_464:3..965
AA seq 320 aa
GFLMKAKNRKVVLIGAGMVGMSFAYQLYSSGLCEELGLIDFFAEKAEGEAMDLNHGGALV
PPIKVTSGGYEQCADADVIVIAGGLPQKPGETRLDLVDKNMKVVKDMSEQIVASGFDGVI
VIASNPVDVLTNALQKFTGFPRNKIVGSGTTLDSSRFRYILGDKLGLAPSSVRGYIIGEH
GDTQLAAWSNVNVYGKQFDRFLETSKYTKEDFADVEEKVMRAAYEVINRKRATYYAIGLA
LFTIVKAILRDENVELAVSGYCDGHYGIDGLYIGTPAIVGREGVREVVELDLTEEETAKM
QHSAKVLKETLEKAYAALEA

KEGG   T30302 (Metagenome): 2992
Entry
2992              CDS       T30302                                 

Gene name
ldh
Definition
L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
spy:SPy_1151 (best score: 193.356)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.2992-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3028:3..365
AA seq 120 aa
VWSHANVAGVKLEQWLQANRDLNEADLVELFISVRDAAYSIINKKGATYYGIAVALARIT
KAILDDENAVLPLSVFQEGQYGVENVFIGQPAIVGAHGIVRPVNIPLNDAETQXGFKKLI

KEGG   T30302 (Metagenome): 8521
Entry
8521              CDS       T30302                                 

Definition
putative L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
oto:ADJ79_08815 (best score: 142.51)
Taxonomy
Betaproteobacteria [GN:oto]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.8521-T1-C
LinkDB
Position
C460640:complement(16..324)
AA seq 102 aa
VEQMKYGGYLVLIGKGSTEFGIAASVTEIIRAYFHDEQKVLPLSCKLEGEYGEHNVFASV
PAIIGKNGIEEILELHLTSDEQKAFHNSCERIREYIKLAHTL

KEGG   T30302 (Metagenome): 11054
Entry
11054             CDS       T30302                                 

Gene name
ldh
Definition
L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
crn:CAR_c01880 (best score: 137.502)
Taxonomy
Firmicutes - Bacilli [GN:crn]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.11054-T1-C
LinkDB
Position
C466560:107..376
AA seq 90 aa
MKKFIKPSNKVILIGDGAVGSSYAYALVLQGIAEELGIIDIAREKTEGDALDLSHALAFN
SPKKIYAASYEDCHDADVICITAGAAQKPG

KEGG   T30302 (Metagenome): 322
Entry
322               CDS       T30302                                 

Gene name
ldh
Definition
L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
sga:GALLO_1129 (best score: 171.014)
Taxonomy
Firmicutes - Bacilli [GN:sga]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.322-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_415:complement(2..277)
AA seq 92 aa
MTSTKQHKKVILVGDGAVGSSYAFALVNQGIAQELGIIEIPQLHEKAVGDALDLSHALAF
TSPKKIYAAQYSDCADADLVVITAGAPQKPGE

KEGG   T30302 (Metagenome): 18727
Entry
18727             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Best hit
oto:ADJ79_08815 (best score: 333.569)
Taxonomy
Betaproteobacteria [GN:oto]
Pathway
00010  Glycolysis / Gluconeogenesis
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
04066  HIF-1 signaling pathway
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.18727-T1-C
LinkDB
Position
C482303:complement(1..621)
AA seq 207 aa
MSIELRKVAIIGTGHVGSHVAFSLATQGEVDQLYMVDIDKDKAIAQATDINDAVSYLPHR
VEAIACEPEDIGDCDILVISAGPLPSPEQDRLDTLGSTVEVLREFLPRVKASGFNGFIVS
ISNPADVVAAYVQEYLNYPKHKIISSGTSLDSARLQRLVAEQIHVHRRSLSCYAMGEHGG
SAMVPWSHVTVSGKPLKELQQELPHRF

DBGET integrated database retrieval system