KEGG   T30302 (Metagenome): 3947
Entry
3947              CDS       T30302                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
hin:HI0059 (best score: 111.694)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.3947-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3912:200..379
AA seq 60 aa
MPFWYSNSKLIWLLSPFSLLFWLISQIRRALFSLGLKSSYRAPKPVIIVGNLSVGGNGKT

KEGG   T30302 (Metagenome): 9683
Entry
9683              CDS       T30302                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
vpr:Vpar_0541 (best score: 109.768)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.9683-T1-C
LinkDB
Position
C463404:1..345
AA seq 115 aa
ILRGYGGGLLMKGEQLFKHIISGQMEGSLGDVLRNGLEKASKVYERVVEYRNERYNHPHR
VLRMPVPVISIGNITVGGTGKTPMVRYVCETLDTAQHTVSVLSRGYKADNNKKPI

KEGG   T30302 (Metagenome): 7834
Entry
7834              CDS       T30302                                 

Gene name
lpxK
Definition
tetraacyldisaccharide-1-P 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
vpr:Vpar_0541 (best score: 131.724)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.7834-T1-C
LinkDB
Position
C458983:complement(3..311)
AA seq 103 aa
DNNKKPIVVSRRGAVDVSSFISGDEAWLLAKTLPNANVIIGSKRVESAKIAVEDMQSDVL
VLDDGFQHRALGRDADIVLIDASHPFGYGAVLPRGLLREPLEN

KEGG   T30302 (Metagenome): 18849
Entry
18849             CDS       T30302                                 

Gene name
lpxK
Definition
tetraacyldisaccharide 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
hin:HI0059 (best score: 387.497)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.18849-T1-C
LinkDB
Position
C482513:3..593
AA seq 196 aa
ECDIIISDDGLQHYQLQRDLEIVVMDAERALGNGFVLPAGPLRELPSRLKSVDFVITNGG
KNQYSDAVMRLVPHFAINLKTNEKRQLKEFQSGVAIAGIGNPQRFFTMLEKLGIQLERTQ
AFQDHQHFEASQLEKLAENQPLFMTEKDAVKCQSFANDNWWYVPVDAEIIEAEKQRENLP
HFWNKIDKLVAQYRNG

KEGG   T30302 (Metagenome): 21647
Entry
21647             CDS       T30302                                 

Gene name
lpxK
Definition
tetraacyldisaccharide 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Best hit
hin:HI0059 (best score: 403.29)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00540  Lipopolysaccharide biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.21647-T1-C
LinkDB
Position
C486675:complement(671..1411)
AA seq 246 aa
SRGYGSQSKIYPLLVTPKTDPVQGGDEPVLIAKRTGVPVVISPNRQQAIELLLKTQDCDL
IISDDGLQHYKLQRDIEIVVMDAERALGNGFVLPAGPLRELPSRLKNVDFVITNGGKNAY
SDAIMQLVPHYAINLVTAEKRLLSEFTQGSAIAGIGNPQRFFTMLENLNIRLENTKAFQD
HQHFEPQLLEKLAENQPLFMTEKDAVKCQAFAKENWWYVPVDAEIVEAENQGQKLPQLWG
KIRHLV

DBGET integrated database retrieval system