T30302 (Metagenome): 4284 Help Entry 4284              CDS       T30302                                  Gene name glgD Definition glucose-1-phosphate adenylyltransferase, glgD subunit   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1123 (best score: 283.493) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.4284-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_4144:complement(2..454) AA seq 151 aa AA seqDB search LPFGGKYRLIDFPLSSLANAGVRSIFGIFQQDNISSVFDHIRSGREWGLSTLLSHYYLGI YNTRVESSTVGKEYYQQLLTYLKRSGSNQTVALNCDVLINIDLNQVFHLHSTTKGPITVV YKKLAKKDISEVNAILEVDETDHFVLINSLI

T30302 (Metagenome): 13122 Help Entry 13122             CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1122 (best score: 162.155) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.13122-T1-C LinkDB All DBs Position C471289:199..438 AA seq 80 aa AA seqDB search MKNEMLALILAGGQGTRLGKLTQSIAKPAVQFGGRYRIIDFALSNCANSGIHNVGVITQY QPLALNSHIGNGSSWGLDGI

T30302 (Metagenome): 15591 Help Entry 15591             CDS       T30302                                  Gene name glgD Definition glucose-1-phosphate adenylyltransferase, glgD subunit   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1123 (best score: 285.419) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.15591-T1-C LinkDB All DBs Position C476501:3..548 AA seq 182 aa AA seqDB search VVYKKLHKENISEVNSVLNIDETDHVRGHKLFDEREDAELFNMSTDIFVVDTPWLIEKLE EEAKKEHPQKLRYVLRDLAVEEGAFAYEYTGYLANIHSVATYYQANLDMLESKKFYSLFS PNQKIYTKVKNEEPTYYAPSSKVSRAQFASGSIVEGEVDNSVISRNTNIKAGSQVKNSIL FP

T30302 (Metagenome): 3381 Help Entry 3381              CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit got:AXE85_04265 (best score: 277.715) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.3381-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_3385:complement(1045..1566) AA seq 173 aa AA seqDB search KDFGKNIIPMMLNEGKNIYAYPFYGYWKDVGTIESLWEANMDLIKNKENFNIDDRLWRIY YRHEGAMPQYLGHSANVKNSMISDGTAVYGTVSESIISSGVRIEEGAEIVGSIIMKDVLI EKGAKVYNSIIAEGSIVKENVEVGHRDITLGKEQITVIGRDEVVKDNRKVEGK

T30302 (Metagenome): 7809 Help Entry 7809              CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit got:AXE85_04265 (best score: 184.111) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.7809-T1-C LinkDB All DBs Position C458933:3..311 AA seq 103 aa AA seqDB search KDFGKNIIPMMLNEGKNIYAYPFYGYWKDVGTIESLWEANMDLIKNKENFNIDDRLWRIY YRHEGAMPQYLGHSANVKNSMISDGTAVYGAVSESIISSGVRI

T30302 (Metagenome): 5555 Help Entry 5555              CDS       T30302                                  Gene name glgD Definition glucose-1-phosphate adenylyltransferase, glgD subunit   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1123 (best score: 361.303) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.5555-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_5134:complement(3..572) AA seq 190 aa AA seqDB search FHDMSTLTDHRPVASLPFGGKYRLIDFPLSSLANAGVRSVFGIFQQDNISSVFDHIRSGR EWGLSTLLSHYYLGIYNTRVESSTVGKEYYQQLLTYLKRSGSNQTVSLNCDVLINIDLNQ VFHLHNTTKGPITVVYKKLPKKDISEVNAILEVDETDHVRSHTLFDRKSTEEMFNMSTDI FVIDTPWLIE

T30302 (Metagenome): 8509 Help Entry 8509              CDS       T30302                                  Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1123 (best score: 129.028) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.8509-T1-C LinkDB All DBs Position C460614:133..324 AA seq 64 aa AA seqDB search MKIDKYSAILGNTVGFHDMSTLTDHRPVASLPFGGKYRLIDFPLSSLANAGIRSIFGIFQ QDNI

T30302 (Metagenome): 17172 Help Entry 17172             CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit hin:HI_1359 (best score: 190.66) Taxonomy Gammaproteobacteria - Others [GN:hin]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.17172-T1-C LinkDB All DBs Position C479569:356..649 AA seq 98 aa AA seqDB search MKAGDLNKYDLVKNTLVLILAGGRGSRLHELTDKRAKPALYFGGNRRIIDFALSNCINSG LNRIGVVTQYAAHSLLRHLQTGWSFLPQEKGEFVDMLP

T30302 (Metagenome): 14771 Help Entry 14771             CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit spn:SP_1122 (best score: 309.301) Taxonomy Firmicutes - Bacilli [GN:spn]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.14771-T1-C LinkDB All DBs Position C474747:3..506 AA seq 168 aa AA seqDB search MNTDANNRIVEFEEKPENPKSTKASMGIYIFDWQRLRNMLVAAENSNVDMSDFGKNVIPN YLESGESVYAYEFAGYWKDVGTVESLWEANMEYINPENALDSRNRRWKIYSRNLISPPNF LSENAKVEDSLVVDGCFVDGTVKHSILSTGAQVRKDAVIEDSVIMSGA

T30302 (Metagenome): 9176 Help Entry 9176              CDS       T30302                                  Gene name glgC Definition glucose-1-phosphate adenylyltransferase   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit got:AXE85_04265 (best score: 235.343) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.9176-T1-C LinkDB All DBs Position C462166:3..335 AA seq 111 aa AA seqDB search FGGKYRIIDFPLSNCANSGISTVGVLTQFMPLELNSYMGNGQPWDLDRMDGGLSILPPYT AGKTGEWYKGTANAIYQNIKYIEQYNPEYVLILSGDHIYKMNYKEMLDFHK

T30302 (Metagenome): 3380 Help Entry 3380              CDS       T30302                                  Gene name glgD Definition glucose-1-phosphate adenylyltransferase, glgD subunit   KO K00975   glucose-1-phosphate adenylyltransferase [EC:2.7.7.27] Best hit got:AXE85_04270 (best score: 520.005) Taxonomy Firmicutes - Bacilli [GN:got]Taxonomy Pathway 00500   Starch and sucrose metabolism 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 02026   Biofilm formation - Escherichia coli Other DBs HMP:  SRS016196.3380-T1-C LinkDB All DBs Position SRS016196_WUGC_scaffold_3385:complement(3..1043) AA seq 347 aa AA seqDB search MVNAFCVLFADNYRNDDLQGLVRNRTLASLAVASRYRMIDFMLSSLVKAEVSNIAVVTNY HYKSLMDHLSWGKDWDLNRKNSGLKFITPMSNHHSNRVAQNKIEALGDASKYADTLLEEY CILADGNIVGNIDFKDMVKYHKTINADITLAYTYRKPQQRESQIIFDDKNRVYDSLYHYD GFEQVCPTQVKIYVMSKQMFKELVKKGTTLGWQDLLLDFITKNFHRLNVYGYEIKNYNRT INSVQEYYNFNRDLLNPDKLNELFLSGTDILTRVADSVPTTYGDGAIVKNSILGDGCEIN GIVESSILFRDVVVEEGAVIKNSIVLPNCVIKKSAYLDCVILDKYAV

DBGET integrated database retrieval system