KEGG   T30302 (Metagenome): 4737
Entry
4737              CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
hso:HS_1702 (best score: 115.931)
Taxonomy
Gammaproteobacteria - Others [GN:hso]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.4737-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4485:190..396
AA seq 69 aa
VEMVVEWVDGLVKDNLHASHHIRHKVAALALTIFCWVFVMNAIDLVPVDFLPQFAGLFGV
HYLRAVPTA

KEGG   T30302 (Metagenome): 20362
Entry
20362             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
rmu:RMDY18_12920 (best score: 197.978)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.20362-T1-C
LinkDB
Position
C484909:632..1045
AA seq 138 aa
LNENGSVLAEGYTPPTPADMHLPDFFQVDSLGFGFGKQMLLVILSVVVVSLFFMMAARKR
AMVPGKAQFIAESGYLFTRNSLGKDLIGAQHFKPFVPLLFTSFFFILINNLYGSIPLIQL
PSFSHPGSAYALAIVGYL

KEGG   T30302 (Metagenome): 14784
Entry
14784             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
gan:UMN179_01202 (best score: 215.698)
Taxonomy
Gammaproteobacteria - Others [GN:gan]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14784-T1-C
LinkDB
Position
C474773:complement(2..466)
AA seq 155 aa
MSGQTSIEYIQHHLTYLTAGEGFWTFNLDTFFFSVLCGFLFLAIFRKVAKKATAGVPSKL
QCAVEMAVEWIDGVVKENYHGKRDVIAPLALTIFVWVMIMNTIDLVPVDYIPQLFAIITG
KHHIPVRAVPTTDMNMTFAMSISVFVLILFYTIKS

KEGG   T30302 (Metagenome): 3460
Entry
3460              CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
got:AXE85_07470 (best score: 274.248)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.3460-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3460:3..488
AA seq 162 aa
GKGLWATALTIISLVAVANTIGVLIEVSYNEVVYVNSVTADPTFTFSLALLIIVFTHFAG
IKYKGVKHYFGTYTSSGIGITPFKVIEEFTNLMTFSMRLFGNIYAGEILLALLATLTTVG
FFGAIAGMVGLVVWKGFSLFIGFIQAYIFTVLTFIYLSHKIS

KEGG   T30302 (Metagenome): 12694
Entry
12694             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
got:AXE85_07470 (best score: 213.386)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.12694-T1-C
LinkDB
Position
C470363:complement(59..424)
AA seq 121 aa
TFSLALLVIVFTHYAGIKYKGTKHYFGTYTSSGIGIAPFKVIEEFTNLLTLSMRLFGNIY
AGEVLLALLATLTTAGVFGAIAGITGLVVWKGFSLFIGFIQAYIFTVLTFIYLSHKISDE
H

KEGG   T30302 (Metagenome): 2356
Entry
2356              CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase F0, A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
spy:SPy_0755 (best score: 283.878)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.2356-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2405:complement(304..1017)
AA seq 237 aa
MEESINPTINIGPVTFDLTLTALTLLSVFLIFAFIYWASRNMTLKPKGKQNVLEYLYDFV
IGFTEPNLGSHYMKDYSLFYLCLFLFMVIANNLGLMAKLQTTDGTNLWTSPTANLSFDLV
LSFCIIVMAHIEGIRRRGIKQYLKGFVTPAFMTPMNLLEEVTNFLSLALRIFGNIFAGEV
MTSLLLLLSHQAIFWYPIAFGTNLVWTAFSVFISCVQAYVFTLLSSMYLGNKINDEE

KEGG   T30302 (Metagenome): 11162
Entry
11162             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
rmu:RMDY18_12920 (best score: 191.045)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.11162-T1-C
LinkDB
Position
C466798:2..379
AA seq 126 aa
YLTWVGVGIKRKGLVGFFKDLTMPSGVPGWVYVILVPIEFLSNLIIRPVTHALRLFATMF
GGHMAMMVAASLTQFLVMSVGGAAALGGIASGALGLFLYFLELMIQVIQAYVFTLLLAVY
LQGSVS

KEGG   T30302 (Metagenome): 15554
Entry
15554             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase F0, A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
spy:SPy_0755 (best score: 196.823)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.15554-T1-C
LinkDB
Position
C476423:complement(3..530)
AA seq 176 aa
MEESINPTINIGPVTFNLTIVVLTLLTVALIFGFIYWATRNMTLRPTGKQNVLEYLFDFV
VGFTKSNLGPMIKDYSLFYFCLFLFMAIANNIGLMARIQTTDGVNLWTSPTANLSFDLVL
SFTIILMTHVEGIRRRGIKKYLKAFVTPGFMTPMNLLEEVTNLLSLALRVFGNIFA

KEGG   T30302 (Metagenome): 11836
Entry
11836             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase F0, A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
spy:SPy_0755 (best score: 92.8189)
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.11836-T1-C
LinkDB
Position
C468369:1..201
AA seq 66 aa
FGNIFAGEVMASMLVLLSHQAFYWYPIAFGTNLIWTAFSVFISCVQAYVFTLLSSMYLGN
KINDEE

KEGG   T30302 (Metagenome): 13846
Entry
13846             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
spy:SPy_0755 (best score: 176.792)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.13846-T1-C
LinkDB
Position
C472835:complement(3..464)
AA seq 154 aa
RKMTLKPSGKQNALEYLYDFVIDFTKGNIGSKYIKNYSLFLFSLFLFLVVANNLGLMAKL
QTTSGENLWTSPTANLGFDLSMSFLITLICHVEGIRRRGVKKYLKAFATPGFMTPMNILE
EFTNFASLALRIYGNIFAGEVLAGLLVTLSHQAF

KEGG   T30302 (Metagenome): 19305
Entry
19305             CDS       T30302                                 

Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
vpr:Vpar_1538 (best score: 164.851)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.19305-T1-C
LinkDB
Position
C483259:complement(511..870)
AA seq 119 aa
SPTNDINTTLGLAISSSILVWIVGLKVKGIGYFKHFVQPFKLFIIINLMEEIAKPVTLAF
RLFGNILAGEILLELLYALVPYVLPIVWLAFSLAIGIIQAFIFAMLVTSYLGMTIGDGH

KEGG   T30302 (Metagenome): 14854
Entry
14854             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
gan:UMN179_01202 (best score: 212.616)
Taxonomy
Gammaproteobacteria - Others [GN:gan]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.14854-T1-C
LinkDB
Position
C474935:complement(2..466)
AA seq 155 aa
MSGQTSIEYIQHHLTYLTTGEGFWTFNLDTFFFSVLCGFLFLAIFRKVAKKATIGVPSKL
QCAVEMAVEWIDGVVKENYHGKRDVIAPLALTIFVWVMIMNTIDLVPVDYIPQLFAIITG
DHHIPVRAVPTTDMNMTFAMSISVFALILFYTIKS

KEGG   T30302 (Metagenome): 18703
Entry
18703             CDS       T30302                                 

Gene name
atpB
Definition
ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Best hit
hin:HI_0485 (best score: 209.534)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00190  Oxidative phosphorylation
00195  Photosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS016196.18703-T1-C
LinkDB
Position
C482267:complement(436..792)
AA seq 118 aa
ILFYTIKSKGIKGLAKEYTLHPFNHWAFIPVNLLLESVTLISKPVSLALRLFGNMYAGEL
IFILIAVMYSANAFVAALGVPLQLVWAIFHILVIALQAFVFMMLTVVYLSIAYNKAEH

DBGET integrated database retrieval system