KEGG   T30302 (Metagenome): 5360
Entry
5360              CDS       T30302                                 

Gene name
ilvE
Definition
branched-chain-amino-acid aminotransferase 2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
got:AXE85_03720 (best score: 144.436)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5360-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4988:complement(202..483)
AA seq 93 aa
MTKLTVNDIRVELTTTPKEKTPDDKLGFGSVFTDHMFVMDWSSDKGWYDPRIVPYGPIPV
SPALNVLHYGQSVFEGMKAYNANGEAXKINLYR

KEGG   T30302 (Metagenome): 11588
Entry
11588             CDS       T30302                                 

Gene name
ilvE
Definition
branched-chain-amino-acid transaminase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
rmu:RMDY18_07670 (best score: 233.032)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.11588-T1-C
LinkDB
Position
C467782:complement(2..391)
AA seq 130 aa
PHRNDALEELGGMNVFFIYGKENKLVTPELTGTILEGVTRSSILQLAKDRGMTVEERPIT
LSEWRDGVASGDITEVCACGTAAVIAPIGKLKAADFEIPAASEGFGEISKSLREELVGIQ
TGTVEDRHGW

KEGG   T30302 (Metagenome): 13634
Entry
13634             CDS       T30302                                 

Definition
raw score 13.64
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
hin:HI1193 (best score: 278.485)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.13634-T1-C
LinkDB
Position
C472405:complement(25..456)
AA seq 143 aa
GTPERKFADAIYLDPKTHTKIEEVGAANFFGITKDNKFITPASESILPSITKYSLLHIAK
ERLGMEAIEGDVYIDQLDQFAEAGACGTAAVITPVGGIQHKGKFHVFYSETEVGPVTRKL
YNELTGIQFGDVEAPEGWIVKVE

KEGG   T30302 (Metagenome): 2790
Entry
2790              CDS       T30302                                 

Gene name
ilvE
Definition
branched-chain-amino-acid transaminase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
spy:SPy_0911 (best score: 302.367)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2790-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2830:complement(2..511)
AA seq 170 aa
PPYGTGGTLYLRPLLIGVGDIIGVKPAEEYIFTIFAMPVGNYFKGGLVPTNFLIQDEYDR
AAPNGTGAAKVGGNYAASLLPGKLAKSRHFSDVIYLDPSTHTKIEEVGSANFFGITADNE
FVTPLSPSILPSITKYSLLYLAEHRLGLTPIEGDVPIDNLDRFVEAGACG

KEGG   T30302 (Metagenome): 7765
Entry
7765              CDS       T30302                                 

Definition
branched-chain-amino-acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
spy:SPy_0911 (best score: 177.178)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7765-T1-C
LinkDB
Position
C458825:1..309
AA seq 103 aa
MKLPYRFLAYYRNGQWEEGKLTEDATLHISESSPSLHYGQQAFEGLKAYRTKDGSVQLFR
PDENAKRLQRTCDRLLMPQVSTEMFVEACKAVVRANEEYVPPY

KEGG   T30302 (Metagenome): 19209
Entry
19209             CDS       T30302                                 

Definition
hypothetical protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
sij:SCIP_0989 (best score: 48.1358)
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19209-T1-C
LinkDB
Position
C483105:3..89
AA seq 28 aa
TLTKLRETLLGIQHGEIEAPEGWIVRIV

KEGG   T30302 (Metagenome): 2192
Entry
2192              CDS       T30302                                 

Gene name
ilvE
Definition
branched-chain-amino-acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
spy:SPy_0911 (best score: 105.145)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.2192-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_2241:complement(46..321)
AA seq 91 aa
LAEHRLGLTPIEGDVPIDNLDRFVEAGACGTAAVISPIGGIQHGDYFHVFYSETEVGPVT
XXXXXDEIEKVALNSRSGPEHNSSFSGLWKS

KEGG   T30302 (Metagenome): 5359
Entry
5359              CDS       T30302                                 

Gene name
ilvE
Definition
branched-chain-amino-acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
got:AXE85_03720 (best score: 136.732)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.5359-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4988:complement(3..236)
AA seq 78 aa
MEKXXKLISIDKEWIPKSEGTSLYVRPFLYGAEEALGVHPNNEVKFVIILSPSGSYFKAG
LQPNKIFVEHEYVRAVRG

KEGG   T30302 (Metagenome): 9901
Entry
9901              CDS       T30302                                 

Gene name
ilvE
Definition
probable branched-chain-amino-acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Best hit
got:AXE85_03720 (best score: 213.001)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00270  Cysteine and methionine metabolism
00280  Valine, leucine and isoleucine degradation
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
00966  Glucosinolate biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9901-T1-C
LinkDB
Position
C463920:3..350
AA seq 116 aa
YVRAVRGGFGFAKTAGNYAGSLKGQKKAQELGYSQSLWLDGVEQKYIEEGGAMNIFFKID
GTFVTPELNGSILPGITRASVLELLKSLGEKVEERKLSLEEVYEAYDNGKLEEVFL

DBGET integrated database retrieval system