KEGG   T30302 (Metagenome): 5924
Entry
5924              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 164.851)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.5924-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5378:364..666
AA seq 101 aa
MISSPTPTRAEVSDCANAILDGADAVMLSGETSVGNYPIITIAAMASIIRDTEEKGLYRV
PQLDRKPRTRGGAITRAAVNIAEQLDVDYISTFTQTGDSAR

KEGG   T30302 (Metagenome): 20138
Entry
20138             CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 194.897)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.20138-T1-C
LinkDB
Position
C484571:665..1003
AA seq 113 aa
MRRAKIVATIGPAISSPEKIAEAIKAGMNVSRLNMSHGDHDVHTNSYTTIREQSAALGKE
VAILADLQGPKIRLERFVNGEEYLKPGADFTITSEDVEGTKDICGTTYKGLPG

KEGG   T30302 (Metagenome): 11620
Entry
11620             CDS       T30302                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 200.675)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.11620-T1-C
LinkDB
Position
C467863:3..392
AA seq 130 aa
IDSIEGTEIHTTVMNTGMMSNRKRVAVPGVSLSLPPVSEQDEKDLVFGCEMGVDYVAASF
MQRASDVVAIRRILESKGADIRIISKIENEEGLNNLDDILEVSDGLMVARGDLGVEIPAE
EVPVLQKMMI

KEGG   T30302 (Metagenome): 6008
Entry
6008              CDS       T30302                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 244.202)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.6008-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5430:complement(149..736)
AA seq 195 aa
YSMVYNPRPTRAEVSDVANAIFDGVDAVMLTEETAIGDYPCEALETLDRIIRTVEKNNAV
DAERFEVEGYKMSISHAVSMTTKHLLEVVDVKSIVTYTKSGTTARFIARYRPNVPVLAVL
PDRESARKLVITRGIVPYIEPKMLSMEEMLSNASSYSKKVGLAEVGDLILITAGQPDTGK
GTVPPTDFVYVSKVD

KEGG   T30302 (Metagenome): 5572
Entry
5572              CDS       T30302                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_01590 (best score: 392.119)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.5572-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5148:3..632
AA seq 210 aa
GITPKDEEDIRFGCKQDIDFVAASFVRTKENVLEVRRILKEEGCEHVQIIPKIECQEAID
NIDEIIEVSDGIMIARGDLGVEVPAEEVPIMQKDIIAKCNEAGKFVITATQMLDSMQKNP
RPTRAEVSDVANAIYDGTDAIMLSGESAAGAYPIESVCTMATIAKRTEEMQDYSRILKER
SKKVVSKDITNAIGVSVGYTALNLDLHTIV

KEGG   T30302 (Metagenome): 5033
Entry
5033              CDS       T30302                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
krh:KRH_11850 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.5033-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4741:complement(261..446)
AA seq 61 aa
YLVEHKLAEPGDLIVIAAGSPPGVAGSTNMVKVHRIKEQGSGEHEPEEREHLSPYGEDEH
K

KEGG   T30302 (Metagenome): 16708
Entry
16708             CDS       T30302                                 

Gene name
pykA
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
hin:HI1573 (best score: 378.252)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.16708-T1-C
LinkDB
Position
C478633:3..614
AA seq 204 aa
NLEKIIAAGANVVRMNFSHGTPDDHIERAERVRSISKKLGKTVAILGDLQGPKIRVSTFK
DGKIFLNVGDKFILDAELPKGEGNQEAVGLDYKTLPQDVVPGDILLLDDGRVQLKVLSTD
GAKVFTEVTVGGPLSNNKGINKLGGGLSADALTEKDKADIITAARIGVDYLAVSFPRSSA
DLNYARELAKQAGLDAKIVAKVER

KEGG   T30302 (Metagenome): 5923
Entry
5923              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 165.622)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.5923-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5378:2..367
AA seq 121 aa
NNKGINLPGAAVSLPALTEKDEADLRFALNLGVDIIALSFVRSGKDVNRVHEIMDEEGIR
IPVIAKIEKPQAVDNLQDIIDKFDGIMVARGDLGVXFRRKLLRWLAAGLSPLSWQLRYLS
P

KEGG   T30302 (Metagenome): 14043
Entry
14043             CDS       T30302                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 182.57)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.14043-T1-C
LinkDB
Position
C473227:3..389
AA seq 128 aa
YKNHKMDIAHAISLSTKYLLDSLDVNNIVTYTKSGSTAKFIARYKPKVQILAVVPSKQNA
RKLALTRGVTTFIEERTLPMEEMLNLAPKFAKESGLAKEGDYILITAGQPDLGKDNVPPT
DFVNIRQV

KEGG   T30302 (Metagenome): 7673
Entry
7673              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 145.206)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.7673-T1-C
LinkDB
Position
C458589:complement(2..307)
AA seq 102 aa
DFVACPFVGNLKEITKVKEIIKSHGKNIGIIVKIDCKDGYDNLDGILEIADAIMINRDEL
GVDISYEDLPGIQKEIVRRANEAAKVVILTTQMLYSMVYNPR

KEGG   T30302 (Metagenome): 14225
Entry
14225             CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 265.003)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.14225-T1-C
LinkDB
Position
C473627:3..482
AA seq 160 aa
QNDVDFVACPFVSNLDEIRKVKDILQVHGKKDIGLIVKIDCKEAYENIDEIIQFADAIMI
NRDELGMELPYENLPSIQKEIIRKANDATVEVILTTQMLHSMIYNPRPTRAEVSDVANAV
IDGVDAIMLIEETATGSYPKEALQTVDKIISYVETQDRVF

KEGG   T30302 (Metagenome): 7702
Entry
7702              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 146.747)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.7702-T1-C
LinkDB
Position
C458659:3..308
AA seq 102 aa
DFVACPFVGNLEEITKVKELVKSHGKNIGIIVKIDCKDGYDNLDDILEIADAIMINRDEL
GVDISYEDLPGIQKEIVRRANEAAKVVILTTQMLYSMVYNPR

KEGG   T30302 (Metagenome): 4030
Entry
4030              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
got:AXE85_07120 (best score: 205.682)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.4030-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3965:1..381
AA seq 127 aa
DRINKIKELRDKLDKNTAIIYDLDHIYAESKYKLIKIEEENVHFACQNDVDFVACPFVSN
LDEIRKVKDILQVQGKKDIGLIVKIDCKEAYESIDEIIQFADSIMINRDELGMELPYENL
PSIQKEI

KEGG   T30302 (Metagenome): 9368
Entry
9368              CDS       T30302                                 

Gene name
pykA
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rpne:NCTC8284_01719 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.9368-T1-C
LinkDB
Position
C462616:complement(3..89)
AA seq 29 aa
MSRKLRRTKIVCTMGPATDRDNNLEKIIA

KEGG   T30302 (Metagenome): 14588
Entry
14588             CDS       T30302                                 

Gene name
pykA
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
hin:HI1573 (best score: 308.916)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.14588-T1-C
LinkDB
Position
C474395:complement(3..497)
AA seq 165 aa
HVERAERVRSIAKKLGKTVAILGDLQGPKIRVSTFKDGKIFLNIGDKFILDSELPKGEGT
QESVGLDYKTLPQDVVPGDILLLDDGRVQLKVLSTDGTKVFTEVTVGGPLSNNKGINKLG
GGLSADALTEKDKADIITAARIGVDFLAVSFPRSSADLNYARELA

KEGG   T30302 (Metagenome): 13969
Entry
13969             CDS       T30302                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
lla:L0003 (best score: 42.3578)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.13969-T1-C
LinkDB
Position
C473065:complement(383..469)
AA seq 28 aa
SGDDIVIVAGVPLGEAVRTNTMRIRTVR

KEGG   T30302 (Metagenome): 2993
Entry
2993              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
lla:L0003 (best score: 43.5134)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.2993-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3028:complement(652..738)
AA seq 28 aa
SGDDIVIVAGVPVGEAVRTNTMRIRTVR

KEGG   T30302 (Metagenome): 17098
Entry
17098             CDS       T30302                                 

Gene name
pykA
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
hin:HI1573 (best score: 387.111)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.17098-T1-C
LinkDB
Position
C479433:2..646
AA seq 215 aa
VARGDLGVEIGDPELVGVQKKLIRRSRQLNRAVITATQMMESMISNPMPTRAEVMDVANA
VLDGTDAVMLSAETAAGQYPSETVTAMAGVCLGAEKMPSINVSRHRMDKKFENIEESVAM
SAMYAANHMKGVAAIVTLTSSGRTPLLMSRISSGLPIFALSRHQETLNLCALYRGVTPVF
YGEDSRTEAAAKAALQSLKEKGYLSAGDLVLLTQG

KEGG   T30302 (Metagenome): 9089
Entry
9089              CDS       T30302                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 137.117)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.9089-T1-C
LinkDB
Position
C461970:complement(3..287)
AA seq 95 aa
MNKKTKIVCTMGPSTDSLEMVESLLRAGMNVARFNFSHGSHEEQAKRMELVRLVSTRTGI
PVALMLDTKGPEIRLGLFKEGKVCLEEGQAFTLTT

KEGG   T30302 (Metagenome): 18802
Entry
18802             CDS       T30302                                 

Gene name
pykA
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
paet:NCTC13378_00828 (best score: 425.246)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS016196.18802-T1-C
LinkDB
Position
C482425:complement(25..804)
AA seq 259 aa
IVAKVERAETVVDEAAMDDIILASDVIMVARGDLGVEIGDPELVGVQKKLIRRSRQLNRA
VITATQMMESMISNPMPTRAEVMDVANAVLDGTDAVMLSAETAAGQYPAETVATMARVCL
GAEKMPSINVSKHRLDREFRDIEESVAMSAMYAANHLNGIAAIITLSHSGRTPLLMSRIS
SGLPIFALSRVQETLNRCALYRGVTPVHFDGESRSSAGAKAAINLLKEKGYLVSGDVVLL
TQGDESEGTTNVCRTLTVE

DBGET integrated database retrieval system