KEGG   T30302 (Metagenome): 5994
Entry
5994              CDS       T30302                                 

Gene name
gnd
Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 124.405)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.5994-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_5419:complement(2..199)
AA seq 66 aa
MKQNIGVIGLSVMGSNLALNIADNGFKVAVFNRTTTVVDKMLEEHPHKNIVGRYSLQELI
DGLEKP

KEGG   T30302 (Metagenome): 12484
Entry
12484             CDS       T30302                                 

Gene name
gnd
Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 196.438)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.12484-T1-C
LinkDB
Position
C469889:complement(2..319)
AA seq 106 aa
MKQNIGVIGLSVMGSNLALNIADNGFKVAVFNRTTSVVDKMLEEHPHKNVTGRYSLQELI
DGLEKPRKIVLMVKAGFAVDSLIEQLTPLLDKGDIIIDGGNSFFKD

KEGG   T30302 (Metagenome): 18297
Entry
18297             CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
hin:HI0553 (best score: 498.434)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.18297-T1-C
LinkDB
Position
C481553:complement(2..748)
AA seq 249 aa
AEWKKTELDSYLIDITTDILGYKDADGEPLVEKILDTAGQKGTGKWTGINALDFGIPLTL
ITESVFARCVSSFKDQRVAANQLFGKTIQPVEGDKKVWIEAVRKALLASKIISYAQGFML
IREASEQFGWDINYGATALLWREGCIIRSRFLGNIRDAYEANPDLIFLGSDSYFKGILEN
ALSDWRKVVAKSIEVGIPMPCMASAITFLDGYTSARLPANLLQAQRDYFGAHTYERTDKP
RGEFFHTNW

KEGG   T30302 (Metagenome): 8487
Entry
8487              CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
npa:UCRNP2_4249 (best score: 140.198)
Taxonomy
Ascomycetes [GN:npa]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.8487-T1-C
LinkDB
Position
C460554:1..321
AA seq 107 aa
DVFAKWNTGLLDSYLIEITAKIMKVKDTDGTPLVEKILDKAGQKGTGKWTSQEGLDLGVP
IPTIAEAVFARAMSAYKSERVLAEPVLAGPTEVFEGDKEALVDAIHS

KEGG   T30302 (Metagenome): 13805
Entry
13805             CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 262.692)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.13805-T1-C
LinkDB
Position
C472765:complement(1..465)
AA seq 155 aa
QVIGEAYDILRSVAGIEPAEQAEIFKKWNETDLSSYLIEITSEVLAQVDAKTGKPLVDVI
LDQAGQKGTGRWTVQAALDLGAPVSAIAESVFARALSSSDVKARAQAQQELPAGLIATTG
VGAGDPEFVEDVRRALFASKLVAYAQGMDMIARAG

KEGG   T30302 (Metagenome): 3692
Entry
3692              CDS       T30302                                 

Gene name
gnd
Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
hin:HI0553 aap:NT05HA_2095 (best score: 129.798)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.3692-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3680:complement(2..199)
AA seq 66 aa
MSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSKVDEFLQGAAKGTNIIGAYSLE
DLASKL

KEGG   T30302 (Metagenome): 19089
Entry
19089             CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
dou:BMF77_04015 anb:ANA_C11873 (best score: 131.339)
Taxonomy
Cyanobacteria [GN:dou]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.19089-T1-C
LinkDB
Position
C482893:complement(554..841)
AA seq 95 aa
KKAFTNNTELNNLMLDPFFAEALQTHQAKWREAIIAAKRYGIPTPAFSASLDYFDSYRRG
VLPANLIQGQRDFFGAHTYERTDKEGTFHTEWAEA

KEGG   T30302 (Metagenome): 17663
Entry
17663             CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
hin:HI0553 (best score: 449.899)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.17663-T1-C
LinkDB
Position
C480451:3..689
AA seq 229 aa
AEWKKTELDSYLIDITTDILGYKDADGEPLVEKILDTAGQKGTGKWTGINALDFGIPLTL
ITESVFARCVSSFKDQRVAANQLFGKTIQPVEGDKKVWIEAVRKALLASKIISYAQGFML
IREASEQFGWNINYGATALLWREGCIIRSRFLGNIRDAYEANPDLIFLGSDSYFKGILEN
ALSDWRKVVAKSIEVGIPMPCMASAITFLDGYTSARLPANLLQAQRDYF

KEGG   T30302 (Metagenome): 11985
Entry
11985             CDS       T30302                                 

Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 151.754)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.11985-T1-C
LinkDB
Position
C468723:162..401
AA seq 80 aa
MTENKKAQIGVTGLAVMGANLARNLARNGYTVALHNRSVEKTDALLSEHGADGDFIRTES
LQGLVDSLESPRRILIMVKA

KEGG   T30302 (Metagenome): 9638
Entry
9638              CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
spn:SP_0375 (best score: 183.341)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.9638-T1-C
LinkDB
Position
C463294:3..293
AA seq 96 aa
TDAYNRDADLANLLLDEYFLDVTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSA
DLPANLIQAQRDYFGAHTYQRKDKEGTFHYSWYDEK

KEGG   T30302 (Metagenome): 1898
Entry
1898              CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
spn:SP_0375 (best score: 243.432)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.1898-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1958:3..356
AA seq 118 aa
MPGGQKEAYELVADVLEEISAKAPEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAE
SYDLMQHLLGLSAEDMAEIFTEWNKGELDSYLIEITADILSRKDDEGQDGPIVDYILD

KEGG   T30302 (Metagenome): 66
Entry
66                CDS       T30302                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 98.5969)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016196.66-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_115:3..284
AA seq 93 aa
WTNEQAIDLGIDVSVITAALNGRYMSNLKEERVRAEQEFTRKPYAVVEDKERLKNIVKDX
XXXXKLLKFSVVDVLFKRKFYKILSKHTKIIQN

DBGET integrated database retrieval system