KEGG   T30302 (Metagenome): 9575
Entry
9575              CDS       T30302                                 

Gene name
crr
Definition
glucose-specific phosphotransferase enzyme IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
gan:UMN179_01985 (best score: 129.028)
Taxonomy
Gammaproteobacteria - Others [GN:gan]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.9575-T1-C
LinkDB
Position
C463148:complement(2..199)
AA seq 66 aa
MGLFDKLFGSKENKSVEVEIYAPISGEIVNIEDVPDVVFSEKIVGDGVAIRPTGNKIVAP
VDGVIG

KEGG   T30302 (Metagenome): 1819
Entry
1819              CDS       T30302                                 

Gene name
crr
Definition
glucose-specific phosphotransferase enzyme IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
hin:HI_1711 (best score: 296.204)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.1819-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1889:complement(37..537)
AA seq 166 aa
MGLFDKLFGSKENKAVEVEIYAPLSGEIVNIEDVPDVVFSEKIVGDGIAIRPTGNKIVAP
VDGVIGKIFETNHAFSMESKEGVELFVHFGIDTVELKGEGFTRIAHEGQSVKRGDTVIEF
DLATLESKAKSVLTPVVISNMDEISSIEKKSGEAIVGESIVLTLKK

KEGG   T30302 (Metagenome): 12928
Entry
12928             CDS       T30302                                 

Gene name
ptbA
Definition
PTS system, glucose subfamily, IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
rmu:RMDY18_00840 (best score: 235.343)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.12928-T1-C
LinkDB
Position
C470861:3..431
AA seq 143 aa
AAPTESTATADIYVAPVTGEYLPLSEVSDPVFSQGVMGDGYAVNPTSNMIVAPAAGTIAL
IQDTMHAFMLRTDNGGEVLVHIGIDTVDLNGEGFTSHAKVGDKVEAGAPIIEVDWEAIKD
RIPSKETMVMVTNTPKFNIVKDS

KEGG   T30302 (Metagenome): 1065
Entry
1065              CDS       T30302                                 

Gene name
ptsG
Definition
PTS system glucose-specific EIICBA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
got:AXE85_03275 (best score: 140.584)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.1065-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1153:complement(2..232)
AA seq 77 aa
MGFLSKLFGKKEEQVQELVLNSYMKGKVVDITEVPDPVFAQKMMGDGFAIIPEEGKLVSP
VAGEIIQVFPTKHAFGI

KEGG   T30302 (Metagenome): 17793
Entry
17793             CDS       T30302                                 

Gene name
crr
Definition
glucose-specific phosphotransferase enzyme IIA component
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Best hit
hin:HI_1711 (best score: 164.851)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00010  Glycolysis / Gluconeogenesis
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
02026  Biofilm formation - Escherichia coli
02060  Phosphotransferase system (PTS)
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS016196.17793-T1-C
LinkDB
Position
C480691:complement(434..703)
AA seq 89 aa
ESKEGVELFVHFGIDTVELKGEGFTRIAQEGQSVKRGDTVIEFDLPLLESKAKSVLTPVV
ISNMDEISCIVKKSGEVVAGESVVLSLTK

DBGET integrated database retrieval system