KEGG   T30302 (Metagenome): 9939
Entry
9939              CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
hin:HI0738 (best score: 187.193)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.9939-T1-C
LinkDB
Position
C464010:complement(56..352)
AA seq 98 aa
RFSGGTSGLSIGHASPEAASGGAIGLVRDGDMINIDIPNRAINLEISNEELAARRTEQDQ
KGWQPANREREVSFALKVFGHFATSADKGAVRDKTLLK

KEGG   T30302 (Metagenome): 879
Entry
879               CDS       T30302                                 

Definition
hypothetical protein
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
spn:SP_2126 (best score: 48.521)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.879-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_964:complement(2..70)
AA seq 23 aa
MSLPGSSSHPAESADKKEDIEAA

KEGG   T30302 (Metagenome): 880
Entry
880               CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
spn:SP_2126 (best score: 98.2117)
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.880-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_964:complement(67..339)
AA seq 90 aa
MTXXXXXXXKEGVKSAGAWPVQFGTITVADGIAMGTPGMXXXXNMDIPAIFAYGGTIAPG
NLDGKDIDLVSVFEGXXQLIPWRLLSKFWV

KEGG   T30302 (Metagenome): 10614
Entry
10614             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
hin:HI0738 (best score: 247.669)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.10614-T1-C
LinkDB
Position
C465572:complement(2..367)
AA seq 122 aa
PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
LSDQLIRLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTANSMNCLTEALGLS
LP

KEGG   T30302 (Metagenome): 3409
Entry
3409              CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
aap:NT05HA_1734 ooi:A6A10_07145 fcl:A4G17_04635 mht:D648_7520
hin:HI0738 (best score: 117.857)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.3409-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_3409:158..328
AA seq 57 aa
VNSFTQFVPGHVHLKDMGQLVAAEIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPS

KEGG   T30302 (Metagenome): 17770
Entry
17770             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
aap:NT05HA_1734 (best score: 457.988)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17770-T1-C
LinkDB
Position
C480643:complement(3..701)
AA seq 233 aa
MGGSSNTVLHLLAAAQEAGVDFKMADIDRLSRVVPCLSKIAPNTNKYHMEDVHRAGGIMG
LLGELDRAGLIHRNTKTVLGTTLEEQLNQYDIIRNKDEELHKFFRAGPAGIRTTQAFSQD
CRWDSVDDDRVSGCIRNKENAISQEGGLAVLFGNIAKDGCIVKTAGVDESIWKFTGRAIV
FESQEDAVAGILGGKVKEGHVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKK

KEGG   T30302 (Metagenome): 12302
Entry
12302             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
rmu:RMDY18_18140 (best score: 231.106)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.12302-T1-C
LinkDB
Position
C469457:3..413
AA seq 137 aa
IADSVEYMVNAHRADALVCISNCDKITPGMLLAAMRLNIPTIFVSGGPMESGEGVEGVVE
HRLDLVDAMVMAVDDSVSDTALAQIEKNACPTCGSCAGMFTANSMNCLNEAIGLALPGNG
TTLATQIARKELFLQAG

KEGG   T30302 (Metagenome): 7939
Entry
7939              CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
hin:HI0738 (best score: 204.527)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7939-T1-C
LinkDB
Position
C459217:complement(3..311)
AA seq 103 aa
GLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEQDDASVLPRSIGTFDAFENAMSL
DIAMGGSSNTVLHLLAAAQEAGVDFKMEDIDRLSRKVPCLSKI

KEGG   T30302 (Metagenome): 8533
Entry
8533              CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
rmu:RMDY18_18140 (best score: 203.371)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8533-T1-C
LinkDB
Position
C460670:complement(3..323)
AA seq 107 aa
LHSLAIAHEAGADFTLDDIDRISRHVPCLAKVAPNSTKYHIEHVHRAGGIPALLGELNRA
GLLHKNVHSVHADSLDEWLAEWDIRSGTASEQAHELFLAAPGGGRTT

KEGG   T30302 (Metagenome): 15988
Entry
15988             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
rmu:RMDY18_18140 (best score: 338.576)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15988-T1-C
LinkDB
Position
C477253:1..570
AA seq 190 aa
GGVRTTQAFSTANKYESHETDAENGCIRAVEHAYTKDGGLAVLRGNIAQNGAIIKSAGID
EELFHFVGKAFVVESQDEAVFEILSKHVNPGDIVVIQYEGPKGGPGMQEMLYPTSYLKGL
GLGKSCALITDGRFSGGTSGISIGHVSPEAAAGGAIGLLETGDEIEIDVHNRILRANVPD
EVLEARRKAK

KEGG   T30302 (Metagenome): 15724
Entry
15724             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
hin:HI0738 (best score: 372.089)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15724-T1-C
LinkDB
Position
C476781:complement(2..556)
AA seq 185 aa
FGKPIIAVVNSFTQFVPGHVHLKDMGQLVAAEIEKAGGVAKEFNTIAVDDGIAMGHGGML
YSLPSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAG
KTKLSDQLIRLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTANSMNCLTEAL
GLSLP

KEGG   T30302 (Metagenome): 19449
Entry
19449             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
aap:NT05HA_1734 (best score: 213.001)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.19449-T1-C
LinkDB
Position
C483511:3..341
AA seq 112 aa
SMGLGKKCALLTDGRFSGGTSGLSIGHASPEAASGGAIGLVHNDDIIEIDIPNRSINLKI
SDEELAKRRTEQDAKGWQPAHREREVSFALKVFGHFATSADKGAVRDKSLLK

KEGG   T30302 (Metagenome): 17115
Entry
17115             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
hin:HI0738 (best score: 441.425)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17115-T1-C
LinkDB
Position
C479463:3..647
AA seq 215 aa
VPCLSKIAPNTNKYHMEDVHRAGGIMGLLGELDRAGLIHKNTHSVLGMSMGEQLDQYDII
RNQDEELHKFFRAGPAGIRTTQAFSQDCRWDTVDNDRVNGCIRNKENAISQEGGLAVLFG
NLAEDGCIVKTAGVDESIWKFTGTAIVFESQEDAVAGILGGKVKEGHVVVIRYEGPKGGP
GMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSG

KEGG   T30302 (Metagenome): 18144
Entry
18144             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
vpr:Vpar_1441 (best score: 347.051)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.18144-T1-C
LinkDB
Position
C481277:61..735
AA seq 225 aa
MNCLTEALGMALPGNGTIPAVYSERLRLAKRAGMQVMEVLQEGLRPKDVLTKEAFENAVA
VDMALGGSSNTALHLPAIAHEAGVSLTLDDFNRIAGDTPQLAKLSPSGKYFIEDLHAAGG
VYAVMHRLQEQGHLHESAKSVSLVDQGTIAKTMKVLDEDVIHPWSDPVYTTGGIAVLKGN
LAPDGSVVKEGAVDPEMLVHSGPAKVFNSEEEAVEAIMGHKIVKG

KEGG   T30302 (Metagenome): 15599
Entry
15599             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
lgo:JCM16774_0695 (best score: 209.534)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.15599-T1-C
LinkDB
Position
C476517:complement(166..549)
AA seq 127 aa
IRYEGPKGGPGMREMLTPTATITGMGLGKDVALITDGRFSGATRGASIGHVSPEAASGGT
IAIVEDGDIIEIDIPNRSLNVKLSEEEIARRKANLAPYKSDVTGYLKKYAMHVSSAAQGA
IEILDEA

KEGG   T30302 (Metagenome): 7106
Entry
7106              CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
spn:SP_2126 (best score: 167.933)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.7106-T1-C
LinkDB
Position
C457233:3..299
AA seq 99 aa
AVLADEVVDGDVVVVRYVGPKGGPGMPEMLSLSSIIVGKGQGDKVALLTDGRFSGGTYGL
VVGHIAPEAQDGGPIAYLRTGDIVTVDQDTKEISMAVSD

KEGG   T30302 (Metagenome): 16061
Entry
16061             CDS       T30302                                 

Gene name
ilvD
Definition
dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Best hit
lgo:JCM16774_0695 (best score: 214.542)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00290  Valine, leucine and isoleucine biosynthesis
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16061-T1-C
LinkDB
Position
C477387:211..573
AA seq 121 aa
MVRSDRVAKGATRAPHRSLLKALGFINEEIGKPIIGIANSFNEIIPGHVHLKNLVQSVKD
GIREAGGIPMEFNTIGICDGLAMNHIGMKYSLVTRNIIADSIEASAMATPFDAMVFIPNC
D

DBGET integrated database retrieval system