KEGG   T30304 (Metagenome): 75926Help
Entry
75926             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 116.701)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.75926-T1-C
LinkDB All DBs
Position
C1520470:complement(2..235)
AA seq 78 aa AA seqDB search
MEDLKKVFAGKLLAIKAVKLQPNDPFTWASGWKSPFYCDNRQTLSYHDVRSFVKLGLTHA
VLEHFPEADAVAGVATGA

KEGG   T30304 (Metagenome): 60410Help
Entry
60410             CDS       T30304                                 

Definition
hypothetical protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ehl:EHLA_2087 (best score: 148.288)
Taxonomy
Firmicutes - Clostridia [GN:ehl]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.60410-T1-C
LinkDB All DBs
Position
C1490738:1..438
AA seq 146 aa AA seqDB search
IRSRENPNLELIAFHGHFATRHSHNSHYLDITRLKHEYSLAYDTALALANHYIYEKSIDT
IICMDGSEVIGAFLARQLTQKILFSVNNNKSICVVTPEYDSNGQLLFRENLVSMIHGRNM
LLLISTVNSGKTARRALDCIQYYGGK

KEGG   T30304 (Metagenome): 65257Help
Entry
65257             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 198.364)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.65257-T1-C
LinkDB All DBs
Position
C1500033:complement(171..476)
AA seq 101 aa AA seqDB search
ELRPGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVIGMVAAYTYGFPVAEEAFKNAKVTL
VTLTNYEAVLDVALRTGYIEEEDIQTLNEWRKDPAHWDAGK

KEGG   T30304 (Metagenome): 81570Help
Entry
81570             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 390.963)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.81570-T1-C
LinkDB All DBs
Position
C1530807:complement(56..673)
AA seq 205 aa AA seqDB search
FAEKLLKIKAIKLQPANPFTWASGWKSPFYCDNRKTLSYPSLRNFVKIEITRLILERFGQ
VDAIAGVATGAIPQGALVADALNLPFVYVRSTPKDHGLENLIEGELRPGMKVVVVEDLIS
TGGSSLKAVEAIRRDGCEVIGMVAAYTYGFPVAEKAFKDAKVPLVTLTNYEAVMEVALRT
GYIEEEDVETLNEWRKDPAHWESGK

KEGG   T30304 (Metagenome): 89187Help
Entry
89187             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 193.356)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.89187-T1-C
LinkDB All DBs
Position
C1544495:3..308
AA seq 101 aa AA seqDB search
ELRPGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVIGMVAAYTYGFPIAEKAFKDAKVPL
VTLTNYEAVMEVALRTGYIEEEDVPTLNEWRKDPAHWEAGK

KEGG   T30304 (Metagenome): 53620Help
Entry
53620             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 172.17)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.53620-T1-C
LinkDB All DBs
Position
C1477288:2..286
AA seq 94 aa AA seqDB search
VVVIEDLISTGGSCIEVVEALREAGAEVLGVASIFTYGMQKGLDRMREANVTNYSLSNLD
ALVEVAAEEGYIKPEDKARLIAFRNNPSDESWMQ

KEGG   T30304 (Metagenome): 105525Help
Entry
105525            CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 355.14)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.105525-T1-C
LinkDB All DBs
Position
C1572581:336..1442
AA seq 368 aa AA seqDB search
MKPVFFSAPERCVSRDDALVGRLVELWEASVRATHDFLSEEDIRGIRTYVPDALRSIADL
RIVRDAEGVPVAFMGCDGRRLEMLFVGPACRGAGVGTALVREAFAAGVTEVVVNEQNPSA
RGFYEHVGFAVCGRSERDEQGGPFPILYMKLNDNNKPNMEKAIAKDLLSIGAVFLRPEQP
FTWASGIKSPIYCDNRLTLTAPEVRKHVEAGLAEIVRTKFPEAEVLMGTSTAGIAHAAIT
ATILDLPMGYVRSGAKDHGRGNRIEGRLEKGQKVVVIEDLISTAGSCIEVVEALREAGAE
VLGVASIFTYGMQKGLDRLAAAGVVNYSLSNLDVLAEVAAEEGYIRPEDKARLIAFRNNP
SDESWINK

KEGG   T30304 (Metagenome): 82501Help
Entry
82501             CDS       T30304                                 

Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 67.3958)
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.82501-T1-C
LinkDB All DBs
Position
C1532605:595..690
AA seq 32 aa AA seqDB search
MEKSIAKDLLSIGAVFLRPEQPFTWASGIKSP

KEGG   T30304 (Metagenome): 94251Help
Entry
94251             CDS       T30304                                 

Definition
hypothetical protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ehl:EHLA_2087 (best score: 213.386)
Taxonomy
Firmicutes - Clostridia [GN:ehl]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.94251-T1-C
LinkDB All DBs
Position
C1553376:3..698
AA seq 231 aa AA seqDB search
THIPIIPTGTMNIKRGGMMMSSMRIKSRENPNLEISAFRGHFATRHSHNSHYLDITRMKH
EYGMAADAAGILVQHYIYEKQIDTIVCMDGSEVIGTFLAGRLAKNDRFSVNSGRNVYVVT
PEYDSNGQLIFRDNLTGMVSGKNVLLLISTVNSGKTARRAMECIEYYGGSLQGIAAVFSA
IAKVDEVPVMSIFSPEDIPGYMTSLVPDCPLCRAGQKIDALANSYGFSVLK

KEGG   T30304 (Metagenome): 115902Help
Entry
115902            CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
pdi:BDI_3691 (best score: 391.734)
Taxonomy
Bacteroidetes [GN:pdi]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.115902-T1-C
LinkDB All DBs
Position
C1587429:complement(2348..2989)
AA seq 213 aa AA seqDB search
MKTLERLVAERLLKIKAVKLQPANPFTWASGWKSPIYNDNRKTLSYPEIRSFIKLELART
ISEKYENADAIAGVATGAIAQGALVADLLGLPFVYIRSTPKDHGLENLIEGELKPGSKVV
IVEDLVSTGGSSLKAVQAVRNFGCDVAGMVAIFTYGFPVAVEAFKEAKVTLTTLSNYDAV
LEEALRTDYIDESEIAVLQEWRKDPANWNPETK

KEGG   T30304 (Metagenome): 99130Help
Entry
99130             CDS       T30304                                 

Definition
hypothetical protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2233 (best score: 542.347)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.99130-T1-C
LinkDB All DBs
Position
C1561910:complement(364..1194)
AA seq 276 aa AA seqDB search
ANSAGRRTGREYAIRTVDRDSLGLDTLRRLDAMGGDLMTLRGDGREGSVVLEVAGFGLTL
GRAPETDSQADLVMKSGRVKLYFFNSGEFGFTKLVGVDYGSYAPEEKGFLDQKLGNSFHC
AASVMQVQVALNKSRTLYFATDLRFAVDNYRLANAGIRLGYEKGRLLPVALDEPADKSKF
VTSSLGIPLRLIYKPFKHFQASVIAYSDFGIELTSLHKKPRVEYELSGLRTYQFGVGGTV
SYYGIGIFASYGVTPLFKKHAGPECHTFSFGISLLM

KEGG   T30304 (Metagenome): 64264Help
Entry
64264             CDS       T30304                                 

Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
dpn:BCB69_02075 (best score: 162.155)
Taxonomy
Firmicutes - Others [GN:dpn]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.64264-T1-C
LinkDB All DBs
Position
C1498161:1..291
AA seq 96 aa AA seqDB search
RGFRVEPGEKVLIVEDIVTTGGSIREVVDVVNEAKGEIVGIGLFVDRSGGKADYGVPADK
VFPLVRLTVPAYRPEECPLCKKGVPITERGSHHLKK

KEGG   T30304 (Metagenome): 82314Help
Entry
82314             CDS       T30304                                 

Definition
hypothetical protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
mbas:ALGA_1193 (best score: 42.743)
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.82314-T1-C
LinkDB All DBs
Position
C1532263:3..71
AA seq 22 aa AA seqDB search
YIKEEDVPMLHEWRKDPANWKK

KEGG   T30304 (Metagenome): 86413Help
Entry
86413             CDS       T30304                                 

Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 141.354)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.86413-T1-C
LinkDB All DBs
Position
C1539711:complement(396..770)
AA seq 124 aa AA seqDB search
AALVADRMKLPTGYVRGENKSHGRQNKIEGRLAEGQKVVLVEDLISTGGSCLEAVKALRE
AGAEVMGVASIFTYNIGRGHENFKKEGCVYKSLCDLEALLDVAVETGYITAEQRAQVIDF
RNSL

KEGG   T30304 (Metagenome): 51496Help
Entry
51496             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
fpr:FP2_15420 (best score: 134.42)
Taxonomy
Firmicutes - Clostridia [GN:fpr]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.51496-T1-C
LinkDB All DBs
Position
C1473030:complement(3..239)
AA seq 79 aa AA seqDB search
MARESIEVLKECEAFLEGHFLLSSGRHSGAYCQMAYLQQYPDKCAEVMAHVAEKLKDTDV
DVIVGPAMGGIVYAYELGR

KEGG   T30304 (Metagenome): 84743Help
Entry
84743             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ere:EUBREC_2468 (best score: 252.677)
Taxonomy
Firmicutes - Clostridia [GN:ere]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.84743-T1-C
LinkDB All DBs
Position
C1536813:370..735
AA seq 122 aa AA seqDB search
MESYKSEFIDFMVESDVLKFGDFTLKSGRKSPFFMNAGAYVTGSQLKRLGEYYAKAIHAN
YGDDFDVLFGPAYKGIPLAVVTAIAYHELYGKEVRYCSDRKEAKDHGADKGGFLGSKLKD
GD

KEGG   T30304 (Metagenome): 12087Help
Entry
12087             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 304.293)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.12087-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_5524:3..479
AA seq 158 aa AA seqDB search
IEITRLILERFGQVDAIAGVATGAIPQGALVADALNLPFVYVRSTPKDHGLENLIEGELR
PGMKVVVVEDLISTGGSSLKAVEAIRRDGCEVIGMVAAFTYGFPVAEEAFKNAKVSLVTL
TNYEAVLDVALRTGYIEKEDIQTLNEWRKDPAHWDAGK

KEGG   T30304 (Metagenome): 34049Help
Entry
34049             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
fpr:FP2_15420 (best score: 92.4337)
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.34049-T1-C
LinkDB All DBs
Position
C1437283:179..307
AA seq 43 aa AA seqDB search
MSEAIEILKSCDAFLEGHFLLSSGRHSSAYCQMAYLQQYPDRC

KEGG   T30304 (Metagenome): 79950Help
Entry
79950             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ere:EUBREC_2468 (best score: 252.677)
Taxonomy
Firmicutes - Clostridia [GN:ere]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.79950-T1-C
LinkDB All DBs
Position
C1527837:282..647
AA seq 122 aa AA seqDB search
MESYKSEFIDFMVESDVLKFGDFTLKSGRKSPFFMNAGAYVTGSQLKRLGEYYAKAIHAN
YGDDFDVLFGPAYKGIPLAVVTAIAYHELYGKEVRYCSDRKEAKDHGADKGGFLGSKLKD
GD

KEGG   T30304 (Metagenome): 12251Help
Entry
12251             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
cpro:CPRO_23610 (best score: 277.33)
Taxonomy
Firmicutes - Clostridia [GN:cpro]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.12251-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_5603:7009..7638
AA seq 209 aa AA seqDB search
MKEIAGYLLKIGAVFLRPEQPFTWASGIKSPIYCDNRLVLTDVEARDAVENAISETVRRR
YPQAQALFGTSTAGIAHCAIAAHILRLPAGYVRSGAKEHGRTNRIEGKLEKGEKVVVIED
LISTGGSVIEVVEALREAGAEVLGIVSIFSYNMSKSAEKLSGANVENVSLSNLDELCEVA
QEKKIIGPEEVRRVLAFRDNPSDESWIKN

KEGG   T30304 (Metagenome): 42227Help
Entry
42227             CDS       T30304                                 

Definition
hypothetical protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ral:Rumal_1623 (best score: 108.612)
Taxonomy
Firmicutes - Clostridia [GN:ral]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.42227-T1-C
LinkDB All DBs
Position
C1454196:complement(2..202)
AA seq 67 aa AA seqDB search
MQQLTYKEEFIRFMVENGVLRFGEFTLKSGRKAPYFINTGNYKTGAQLARLGAYYAACVH
DNGLQAD

KEGG   T30304 (Metagenome): 22406Help
Entry
22406             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ere:EUBREC_2468 (best score: 221.09)
Taxonomy
Firmicutes - Clostridia [GN:ere]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.22406-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_9103:1..339
AA seq 112 aa AA seqDB search
GSKLKDGDRVVMIEDVTTSGKSMEETVPKVRGAADVTIVGLMVSLNRMEVGQGGKVSALD
EIHEKYGFEGKSIVTMAEVTEYLYNREHDGRVVIDDTIKAAIDEYYKQYGCK

KEGG   T30304 (Metagenome): 6483Help
Entry
6483              CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 369.392)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.6483-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_3044:complement(600..1238)
AA seq 212 aa AA seqDB search
MKTLEKLFAEKLLKIKAIKLQPANPFTWASGWKSPFYCDNRKTLSYPSLRNFVKLEISRI
VLEKFGQVDAIAGVATGAIPQGALVAEELNLPFVYVRSTPKDHGLENLIEGELRPGMKVV
VIEDLISTGGSSLKAVEAIRRDGCEVIGMVAAFTYGFPVAIEAFKEAKVNLVTLTNYEAV
LDSALKTGYINEEDVPVLDNWRKDPAHWEAGK

KEGG   T30304 (Metagenome): 5183Help
Entry
5183              CDS       T30304                                 

Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ere:EUBREC_2283 (best score: 431.795)
Taxonomy
Firmicutes - Clostridia [GN:ere]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.5183-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_2399:903..1541
AA seq 212 aa AA seqDB search
MENRIVKFKSKESAGLNLHAIPGHFATSHSHINYYVDVTSIKTRVSEAKEAAKALYTKVP
HHSYIDTIVCMDGTEMIGAFLSQEIERNGLMSVNKHETIYVVSPEINNGQMLFRDNNKGA
IDGKHVVLLLATTTTGETIRRAMECINYYGGMVTCIASIFSTIDEVNGVKIDKLFDDDDV
VNYQTYPVTECPFCKKGLPIEAMVNGFGYSKL

KEGG   T30304 (Metagenome): 98717Help
Entry
98717             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 67.3958)
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.98717-T1-C
LinkDB All DBs
Position
C1561236:complement(3..101)
AA seq 33 aa AA seqDB search
MEKKIAKDLLSIGAVFLRPEQPFTWASGIKSPI

KEGG   T30304 (Metagenome): 104866Help
Entry
104866            CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 331.257)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.104866-T1-C
LinkDB All DBs
Position
C1571567:complement(480..1112)
AA seq 210 aa AA seqDB search
MEREIAKGLLSIGAVFLRPEQPFTWASGIKSPIYCDNRLILTAPEVRKKVEAAIAETVKA
KFPACEVLMGTSTAGIAHAAIAATILDLPMGYVRSGSKDHGRGNQIEGKLDKGQKVVVIE
DLISTAGSCIEVVEALRAAGAEVLGVVSIFTYGMKKGLERLAAADVINHSLSNLDALVEV
AAEEGYIKPEDRQRLIAFRDNPSDESWINK

KEGG   T30304 (Metagenome): 106538Help
Entry
106538            CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 201.06)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.106538-T1-C
LinkDB All DBs
Position
C1574180:1296..1739
AA seq 148 aa AA seqDB search
VNKMKEIAKDLLDIKAVFLSPSKPFTWASGIQSPIYCDNRLTLSYPVIRKKIEQEMANII
KETYSQVEILMGTSTAGIPHAAYISALLDLPMGYVRSRAKSHGRENQIEGKYEKGQKVVV
IEDLISTGGSSIEVVKTLEEAGLIVIGV

KEGG   T30304 (Metagenome): 113157Help
Entry
113157            CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
pary:A4V02_02380 (best score: 324.324)
Taxonomy
Bacteroidetes [GN:pary]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.113157-T1-C
LinkDB All DBs
Position
C1584151:84..734
AA seq 216 aa AA seqDB search
MKKLESILAEKLLKISAIKLQPDNPFTWSSGWNSPIYTDNRKTLSYPETRSFLKVEMSRL
IIENFPDAEVVAGVATGAIALGALVADTLGKPYIYVRSSPKDHGLENLIEGNLKPGQKVV
VIEDLVSTGGSSLKAVEAVRNAGAEVVGMLAIFTYQFPLAEENFKKAGVKLLTLGNYTAM
LDAALKINYIKEADLETLKLWRQDPENWTPTATIDE

KEGG   T30304 (Metagenome): 79575Help
Entry
79575             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
afd:Alfi_2314 (best score: 347.436)
Taxonomy
Bacteroidetes [GN:afd]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.79575-T1-C
LinkDB All DBs
Position
C1527153:3..560
AA seq 185 aa AA seqDB search
ASGIKSPIYCDNRLTLTAPVVRGHVEEGLAQIVRTRFPEAEVLMGTSTAGIAHAAITATI
LDLPMGYVRSGSKDHGRGNQIEGKLEKGQKVVVIEDLISTGGSCIEVVTALREAGAEVLG
VASIFTYGMKKGLDRMKEANVVNYSLSNLDALVEVAAEEGYIKPEDKARLLKFRDNPSDE
SWMEK

KEGG   T30304 (Metagenome): 63226Help
Entry
63226             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ped:ING2D1G_1019 (best score: 72.7886)
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.63226-T1-C
LinkDB All DBs
Position
C1496126:complement(245..460)
AA seq 71 aa AA seqDB search
GLIVIGVVAIFSYNLEVAKVNFEKIKCPVSVLTNYDELLEVAVSFNYIDHVAKEKLLKWK
LNPHDESWMKD

KEGG   T30304 (Metagenome): 10390Help
Entry
10390             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
ehl:EHLA_2114 (best score: 396.741)
Taxonomy
Firmicutes - Clostridia [GN:ehl]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.10390-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_4827:complement(1998..2675)
AA seq 225 aa AA seqDB search
MEAYKKEFIEFMVDCQVLKFGDFVTKSGRKTPFFVNTGFYRTGAQLRRLGQYYAEAVNSK
FGLDFDVLFGPAYKGIPLSVAATIAISEKYGQDIRYCSNRKEVKDHGDKGILLGSPINDG
DRVVIIEDVTTAGTSIEETLPIIKAQGDVNPIGLVVSVDRMERGKGTKSALSEIEEKYGL
KTTAIVTMAEVVEHLYNKEYKGKVIIDDKLKAAIDAYYEQYGVKE

KEGG   T30304 (Metagenome): 77966Help
Entry
77966             CDS       T30304                                 

Definition
putative phosphoribosyl transferase domain protein
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
fpr:FP2_32010 (best score: 118.242)
Taxonomy
Firmicutes - Clostridia [GN:fpr]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.77966-T1-C
LinkDB All DBs
Position
C1524201:complement(436..618)
AA seq 60 aa AA seqDB search
VAGLSAIFATATECLGIPVTSIFDPSNLPDYASFDSRECPMCKAGQHIDALVNSFGYSAL

KEGG   T30304 (Metagenome): 26365Help
Entry
26365             CDS       T30304                                 

Gene name
pyrE
Definition
orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Best hit
bth:BT_3731 (best score: 397.127)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00240  Pyrimidine metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016203.26365-T1-C
LinkDB All DBs
Position
SRS016203_WUGC_scaffold_10147:2629..3267
AA seq 212 aa AA seqDB search
MRTLEKLFAEKLLKIKAIKLQPANPFTWASGWKSPFYCDNRKTLSYPSLRNFVKIEITRL
ILERFGQVDAIAGVATGAIPQGALVADALNLPFVYVRSTPKDHGLENLIEGELRPGMKVV
VVEDLISTGGSSLKAVEAIRRDGCEVIGMVAAYTYGFPVAEKAFKDAKVPLVTLTNYEAV
LDVALRTGYIEEDDIATLNEWRKDPAHWDAGK

DBGET integrated database retrieval system